MG_271_MONOMER – dihydrolipoamide dehydrogenase

Name
WID MG_271_MONOMER View in model
Name dihydrolipoamide dehydrogenase View in model
 
Genetics
Gene MG_271 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
MDYDLIILGAGPAGYIAAEYAGKHKLKTLVIEKQYFGGVCLNVGCIPTKT
LLKRAKIIDYLVHAKDYGITINGQAKLDWKQLLKQKQEVVDKLVAGVKTI
IKGAKVESIEGEATVIDKNKVQVNNTTYTTNNIIVATGSRPRYLTLPGFE
KAQQAGFIIDSTQALALEGVPKKFVVVGGGVIGVEFAFLFASLGSEVTII
QGVDRILEVCDSDVSELISKTLKNKGVQIITNAHVVRAENNQLFYTVNGV
EQSVIGDKILVSIGRIANTECLDQLDLKRDHNNKIVLNEKLQTSTTNIYL
IGDVNTQMMLAHYAYQQGRYAVDQILNQNQVKPAEKNKCPACIYTNPEVA
FVGYSEMELQKEKIDYVKSSLPFIYSGKAIADHETNGFVKMMFNPKTGAI
LGGCIIASTASDIIAELALVMENNLTVFDIANSISPHPTMNEMVTDVCKK
AIFDYFS*
50
100
150
200
250
300
350
400
450
458
View in model
Is N‑terminal methionine cleaved
Yes
View in model
Disulfide_bonds MG_271_272_273_274_192MER_ox: 40-45 View in model
Empirical formula (pH 7.5) H3612C2249N585O671S17
Molecular weight (pH 7.5; Da) 50127.22 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
33320
Instability index 29.27
Is stable True
Aliphatic index 103.43
GRAVY (25C, pH 7.0) 0.0262
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_305_MONOMER, MG_392_393_21MER View in model
 
Function
Complex subunit pyruvate dehydrogenase
[c]: (12) MG_271_MONOMER + (60) MG_272_MONOMER + (60) MG_273_MONOMER + (60) MG_274_MONOMERMG_271_272_273_274_192MER
View in model
 
Comments
Comments first observed N-terminal residue by mass-spec 1 [PUB_0280] Functional Macromolecule Functional as hetercomplex (see MG_271_272_273_274_192MER). Coenzymes Interacts with 1 FAD per monomer as coenzyme [96]. N-terminal methionine cleavage Shewanella oneidensis MR-1 homolog undergoes N-terminal methionine cleavage [PUB_0280].
References
  1. Gupta N, Tanner S, Jaitly N, Adkins JN, Lipton M, Edwards R, Romine M, Osterman A, Bafna V, Smith RD, Pevzner PA. Whole proteome analysis of post-translational modifications: applications of mass-spectrometry for proteogenomic annotation. Genome Res 17, 1362-77 (2007). WholeCell: PUB_0280, PubMed: 17690205

 
Metadata
Created 2012-10-01 15:07:55
Last updated 2012-10-01 15:14:38