MG_266_MONOMER – leucyl-tRNA synthetase

Name
WID MG_266_MONOMER View in model
Name leucyl-tRNA synthetase View in model
Cross references PDB: 2AJI
 
Genetics
Gene MG_266 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
651
701
751
MYNHNLIEEKWLKKWKNKDVNRFESDSNKKKYYVLDMFPYPSAAGLHLGH
VRAYTITDVISRYYKAKGFNVIHPIGFDAFGLPAEQYAINSNQNPGSWTD
QNINNFINQLTSFGFDYDYHLSLKTTDPRYYKYTQWIFSELFKANLAELV
DIDVNWCEQLGTVLANEEVLIDSNGNAVSERGSFSVEKRKMKQWVLKITT
FADALLEGLDTLDWPEPIKEMQRNWIGKSKGVTINFQLKDHKEAIAIFTT
KPQTIFGVSFLAVSTNHWLAKKIAETNKKVASFLKKQLQKTTTLKQKATL
YDGIDLLTNAIHPLTNELIPVYVANYVIEGYGTDAIMGVGAHNENDNFFA
RKQKLKIINVIDKKERLQNSFAYNGLTTKEAQVAITNELISQNKAKLTTV
YKLRDWIFSRQRYWGEPFPIIFDENNTPHLVEQLPVELPLLENYKPDGSG
NSPLMRNQAWVNIVKDNIHYQRETNTMPQWAGSCWYYLGYLMLIKNPNFW
PIDSKEAKKLFDQYLPVDLYVGGAEHAVLHLLYARFWHKFLFDKKLVSTK
EPFQKLINQGMVLGPDGKKMSKSKGNTINPTPLVDSHGADALRLYLMFMG
PISASLTWNDEGLNGMRRWLDRVYNFFFNHAVVTDQVSQETIFAYNLFLK
NSYCHLDKHELNLVISEMMIFLNFLYKTKKISLNYAKGFLTVLSFFAPFL
AEELNEKCGLEPFVVKQAISLVDYQLFETAKTKVILSINGKFKAAKEFTK
GSLEIDVLESFKQDKEINDILNQPIERVVYVQDRIINVLLKK*
50
100
150
200
250
300
350
400
450
500
550
600
650
700
750
793
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H6470C4205N1075O1175S19
Molecular weight (pH 7.5; Da) 91491.84 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
153140
Instability index 27.55
Is stable True
Aliphatic index 90.37
GRAVY (25C, pH 7.0) -0.309
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_305_MONOMER View in model
 
Function
Enzyme View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0095, PUB_0357].
References
  1. Hunter S, Apweiler R, Attwood TK, Bairoch A, Bateman A, Binns D, Bork P, Das U, Daugherty L, Duquenne L, Finn RD, Gough J, Haft D, Hulo N, Kahn D, Kelly E, Laugraud A, Letunic I, Lonsdale D, Lopez R, Madera M, Maslen J, et al. InterPro: the integrative protein signature database. Nucleic Acids Res 37, D211-5 (2009). WholeCell: PUB_0095, PubMed: 18940856, URL: http://www.ebi.ac.uk/interpro/

  2. Williamson RM, Oxender DL. Sequence and structural similarities between the leucine-specific binding protein and leucyl-tRNA synthetase of Escherichia coli. Proc Natl Acad Sci U S A 87, 4561-5 (1990). WholeCell: PUB_0357, PubMed: 2191293

 
Metadata
Created 2012-10-01 15:07:55
Last updated 2012-10-01 15:14:38