MG_264_MONOMER – dephospho-CoA kinase

Name
WID MG_264_MONOMER View in model
Name dephospho-CoA kinase View in model
Cross references PDB: 1VIY
 
Genetics
Gene MG_264 View in model
 
Structure
Sequence
1
51
101
151
MLIAIVGKPGVGKTSLLQYLKDNYHFSVFYADSFIHEQYQKNNPGYQLIM
DHFGKEFVNQTEVDRKKLANYVFSDDKLIEKLSLVTKPLLIAWIKSLKTQ
FQKKLALIEIAVMLNYWNEYRSLFDYVIKLERDDQLVNLALQQRNSHKKV
KDLIKEPNCKIDTIFNNDSIATAALKLIKLLETFLERNKCRCDCCHIQ*
50
100
150
199
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1681C1059N275O294S8
Molecular weight (pH 7.5; Da) 23225.80 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
25035
Instability index 22.46
Is stable True
Aliphatic index 103.37
GRAVY (25C, pH 7.0) -0.251
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Enzyme dephospho-CoA kinase
[c]: ATP + DPCOAADP + COA + H
View in model
 
Comments
Comments Functional Macromolecule Exists as monomer in solution [PUB_0006]. May form homotrimer, athough the role of the trimer is unclear [PUB_0006].
References
  1. Keseler IM, Bonavides-Martínez C, Collado-Vides J, Gama-Castro S, Gunsalus RP, Johnson DA, Krummenacker M, Nolan LM, Paley S, Paulsen IT, Peralta-Gil M, Santos-Zavaleta A, Shearer AG, Karp PD. EcoCyc: a comprehensive view of Escherichia coli biology. Nucleic Acids Res 37, D464-70 (2009). WholeCell: PUB_0006, PubMed: 18974181

 
Metadata
Created 2012-10-01 15:07:55
Last updated 2012-10-01 15:14:38