MG_263_MONOMER – Cof-like hydrolase

Name
WID MG_263_MONOMER View in model
Name Cof-like hydrolase View in model
 
Genetics
Gene MG_263 View in model
 
Structure
Sequence
1
51
101
151
201
251
MKNEIKYLYSDLDGTIVSWNPKTEFVYQNKSYKNFHEVSDATISAFYRLQ
QKGIKVGIVTGRDYCRVLWLEKQLRTGLPTITLDGAIIFYQNEILSQTYL
DDRFIEGINNIVKRFPEAAYKLNSGWISYFTKNPSVIFEIDYAFLGYFNP
NTKLQKKFIDSTENWDLNKLKVNQVYFDIDTCPLAMQKEIIELISVSDVN
AKIYEHSMYIIKNGVSKASALQSLNQFAIPITKDNTIVCGDGDNDIEMMQ
WAKHSVSLIGSNPKCFALAKYHTDSVDNDGIANWIEKNLLC*
50
100
150
200
250
292
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2334C1520N383O446S10
Molecular weight (pH 7.5; Da) 33429.65 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
57465
Instability index 27.99
Is stable True
Aliphatic index 91.82
GRAVY (25C, pH 7.0) -0.247
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Metadata
Created 2012-10-01 15:07:55
Last updated 2012-10-01 15:14:38