MG_262_MONOMER – polI-like 5'-3' exonuclease, putative

Name
WID MG_262_MONOMER View in model
Name polI-like 5'-3' exonuclease, putative View in model
 
Genetics
Gene MG_262 View in model
 
Structure
Sequence
1
51
101
151
201
251
MKKAILIDGNSLAYRAYFATWKQVEYAKQNNLPFNNAIRTMLLMCWNLIK
ANVYQYGIVSFDTKAPTFRDQIYEGYKQKRVKTPVELLVQIPLIKQALVY
LGFLVCEKDGFEADDLIGSYANLFTKQEITVDIYSSDRDMLQLVNAFTNV
FLCIKGTKEMVMYNNENFKSLFYGLAPYQVVEYKGLVGDNSDNLAGIKGI
GPIKGIELLQQYGTIDNIYTNFNNLPNQLQKLLNNQKEIAKTFSFLAKIK
TDIELDQNIDLTGLKPIQKQALIQLLSENKINTLVEKFSKI*
50
100
150
200
250
292
View in model
Is N‑terminal methionine cleaved
Yes
View in model
DNA footprint Length: 20 (nt), Binding: dsDNA, Region: dsDNA View in model
Empirical formula (pH 7.5) H2402C1523N380O435S9
Molecular weight (pH 7.5; Da) 33284.14 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
35215
Instability index 23.68
Is stable True
Aliphatic index 103.18
GRAVY (25C, pH 7.0) -0.133
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Enzyme View in model
Reaction participant View in model
 
Parameters
Parameters Parameter_0049: HR_PolA_ResectionLength = 8 b View in model
 
Comments
Comments N-terminal methionine cleavage Shewanella oneidensis MR-1 homolog undergoes N-terminal methionine cleavage [PUB_0280]. DNA-binding PolA resects DNA ends 8 bp [PUB_0526]. Pol I completely protects 1-3 nt [PUB_0741]. E. coli DNA polymerase I has 20 nt footprint [PUB_0742].
References
  1. Daley JM, Wilson TE. Rejoining of DNA double-strand breaks as a function of overhang length. Mol Cell Biol 25, 896-906 (2005). WholeCell: PUB_0526, PubMed: 15657419

  2. Gilson E, Perrin D, Hofnung M. DNA polymerase I and a protein complex bind specifically to E. coli palindromic unit highly repetitive DNA: implications for bacterial chromosome organization. Nucleic Acids Res 18, 3941-52 (1990). WholeCell: PUB_0741, PubMed: 2197600

  3. Gupta N, Tanner S, Jaitly N, Adkins JN, Lipton M, Edwards R, Romine M, Osterman A, Bafna V, Smith RD, Pevzner PA. Whole proteome analysis of post-translational modifications: applications of mass-spectrometry for proteogenomic annotation. Genome Res 17, 1362-77 (2007). WholeCell: PUB_0280, PubMed: 17690205

  4. Xu Y, Grindley ND, Joyce CM. Coordination between the polymerase and 5'-nuclease components of DNA polymerase I of Escherichia coli. J Biol Chem 275, 20949-55 (2000). WholeCell: PUB_0742, PubMed: 10806216

 
Metadata
Created 2012-10-01 15:07:55
Last updated 2012-10-01 15:14:38