MG_261_MONOMER – DNA polymerase III, alpha subunit

Name
WID MG_261_MONOMER View in model
Name DNA polymerase III, alpha subunit View in model
Cross references PDB: 2HQA
 
Genetics
Gene MG_261 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
651
701
751
801
851
MFVNLHTNSYYNFLNSALSPKKLVNLAINDQQKAVAITDPNLFGAVEFFI
TCKQNNIKPIIGLNLTVEYQKNDVKLLLIAKSNKGFQTLNKIALIQQKLE
INSLVDQLTDIAVIICSLTTWKSTYKDVYQAKGIEINQTPIAILANAVNC
EKTNSDQVVLTVLKQMKQNQTGKITTFDWDLKQKLNQISINENLKVKSEI
QPFLDQKTAQQLFSETELNNLNDLVNRCELDLEHLKAASLSLTDNDAAVL
ESLCQTNLKQFLDKNQDLNKKAYQLRLEKELNVINKLNFASYFLVVNDLV
NYAFKKDILIGSGRGSAVGSLVAFLLNITKIDPVQHQLIFERFISTHRQD
LPDIDIDIMENKRAEMINYLFEKYGKENCAQIVTFQRFKTRSAVKEVAKL
FNDYGISDMILGVLPKDQTITFTDLKATEDSALQLCLQQFGLIVELALAI
VDFPRQSSIHASGIVIASNSLIKTIPLLQLDNNHFLTQVSMEWLSFFNLN
KFDLLGLINLTMISDVITQIKPSNQTVNQFLNTISWTDQNTFINLVNEDT
LGIFQLESFGMKKLLVQIKPKTINQLAIVLALYRPGAQDNINLFINRLHN
GYDQSDIDPRILPIVKNTYGVLIFQEQIINIVKVVANYSLEEADSFRRAI
SKKDVKLIQKNKRNFFERAVQNNFDLKTTTKIFSYIERFANYGFNLSHAL
GYALLSYWTAWLKTNYPVYFYLWLLNHFQSSKDKQKLIIRTLEKSGIEIY
PPLLNKAQPNSVIENKKIYLGLNLIKGINDRYIQNLQKVQHLIQTQNNLQ
LTDVVSWCLDKTIGDIPLKDLLLLKTMGCFDFFEYTYDFNDAKDFWIKSD
HLLFTRMPLEKKDSNFWIKQFFTN*
50
100
150
200
250
300
350
400
450
500
550
600
650
700
750
800
850
875
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H7250C4579N1179O1314S19
Molecular weight (pH 7.5; Da) 100450.62 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
96355
Instability index 25.43
Is stable True
Aliphatic index 108.41
GRAVY (25C, pH 7.0) -0.117
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit DNA-directed DNA polymerase
[c]: MG_031_MONOMER + MG_261_MONOMERDNA_POLYMERASE_CORE
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see DNA_POLYMERASE_CORE) [PUB_0312, PUB_0313, PUB_0314]. Complex composition inferred from B. subtilis DNA pol III holoenzyme structure [PUB_0428].
References
  1. Bruck I, O'Donnell M. The DNA replication machine of a gram-positive organism. J Biol Chem 275, 28971-83 (2000). WholeCell: PUB_0314, PubMed: 10878011

  2. Kelman Z, O'Donnell M. DNA polymerase III holoenzyme: structure and function of a chromosomal replicating machine. Annu Rev Biochem 64, 171-200 (1995). WholeCell: PUB_0312, PubMed: 7574479

  3. Razin S, Herrmann R. Molecular biology and pathogenicity of mycoplasmas. Springer (2002). WholeCell: PUB_0428, ISBN: 9780306472879

  4. Razin S, Yogev D, Naot Y. Molecular biology and pathogenicity of mycoplasmas. Microbiol Mol Biol Rev 62, 1094-156 (1998). WholeCell: PUB_0313, PubMed: 9841667

 
Metadata
Created 2012-10-01 15:07:55
Last updated 2012-10-01 15:14:38