MG_260_MONOMER – lipoprotein, putative

Name
WID MG_260_MONOMER View in model
Name lipoprotein, putative View in model
 
Genetics
Gene MG_260 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
651
701
751
MKLKGFLAVGVSVFGFSGLLMACSVVSQFDQVDDGKIKLASSLTSKRAAE
ALETVVKKYNDTKDPGDYPIEIVQIAGGYDGGKKDVQTKVSTKDKNNFYN
LILNYPEIVSTLSRSKMALNFDGVNVDKLHPNFLSFNSRIGGIRDDGIYA
IPISMSTDLMVINGPVLHYILNSARKEGTPTSTTVQATVSSRSAEKKGTL
EIANDSETTKLWQNIQTTAQNNSNETTKEQKQVKRSSSSSSTTSTTGETK
DTTKSDNKIKEFWGEYQEVDGGLKNFTFKASIFENWNETLDFATRIANSF
PEKVKNITNKTGLDLQGVLGVDSSSNALYAAVFAAGQANYDNFFFNIDKR
TGYADYSNFLNKDSSYQNLESVYNDFYKLIQANGLFVNRGGSYSSNFEKF
HQLAFSVSSSGGYSYYFAKDNAKRLKFSNYAIEYPSFTQTIQAPNSSETE
SNLLGTFKLSEKDINLYKGSIPSGKQQGVDAILISNPNLINILEQAKQKN
TAQGSESTTNKIIGYTTTANVNVDNQNIFSVSKLNNEQFQRKIIVNATEE
TLDQSQTLQSNESIVLPMPGKYKSTDKNKVMITQGPNLIGIHANEKENIE
TKKFVNWFLNQSITDWNSNNQQKNSDQTTKTAAEYFTDQASYILPLKEKF
NKSSDLELKGSSSSSNLTTSSASASLLISNNSSTASSPAPKKTNNNSNTF
TAKALELFQQAANNEIIPFSDPSDFRNGTFRNNISSSFNAAVNSKVSFNQ
FVQNFINSLGSGFRR*
50
100
150
200
250
300
350
400
450
500
550
600
650
700
750
766
View in model
Is N‑terminal methionine cleaved
No
View in model
Sequence sequence Type: lipoprotein, Location: N, Length: 22 (nt) View in model
Empirical formula (pH 7.5) H5820C3721N1009O1215S8
Molecular weight (pH 7.5; Da) 84386.34 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
66365
Instability index 39.86
Is stable True
Aliphatic index 71.19
GRAVY (25C, pH 7.0) -0.553
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Comments
Comments Signal Peptipde Signal peptide of length 22 (SPdb331864, MKLKGFLAVGVSVFGFSGLLMA) predicted by SPdb [PUB_0253].
References
  1. Choo KH, Tan TW, Ranganathan S. SPdb--a signal peptide database. BMC Bioinformatics 6, 249 (2005). WholeCell: PUB_0253, PubMed: 16221310, URL: http://proline.bic.nus.edu.sg/spdb/

 
Metadata
Created 2012-10-01 15:07:55
Last updated 2012-10-01 15:14:38