MG_258_MONOMER – peptide chain release factor 1

Name
WID MG_258_MONOMER View in model
Name peptide chain release factor 1 View in model
Cross references PDB: 2B3T
 
Genetics
Gene MG_258 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
VDFDKQLFFNVEKIVELTEQLEKDLNKPNLSFEQIKVINKELKHKQPLIV
KFKELQKLVENANEAEQILNNSSLKELHEEAKKELEKIKASLPSLEEEIK
FLLLPVDENNQKNVIVEIRPAAGGDESCIFLSDLFNMYKNYCTSKNWTVE
LNEIIPASVGINFVSFAVNGTDVFAKLKFESGVHRVQRVPLTEAKGRVHT
STVTVAVLPQLEEVEITINPSDLRIDTYRASGAGGQHVNRTESAVRITHL
PTGIVVACQEGKSQFSNRDKAMKMLRAKLWENAQNKQLSTQADLRKSQVG
SGERAEKIRTYNYPQNRITDHRIKLTINKLNTVILGDLDEIIEALQADEK
KQQLEKFIS*
50
100
150
200
250
300
350
360
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2935C1811N501O554S6
Molecular weight (pH 7.5; Da) 40782.98 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
18825
Instability index 35.41
Is stable True
Aliphatic index 96.92
GRAVY (25C, pH 7.0) -0.453
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0325].
References
  1. Andjelković N, Zolnierowicz S, Van Hoof C, Goris J, Hemmings BA. The catalytic subunit of protein phosphatase 2A associates with the translation termination factor eRF1. EMBO J 15, 7156-67 (1996). WholeCell: PUB_0325, PubMed: 9003791

 
Metadata
Created 2012-10-01 15:07:55
Last updated 2012-10-01 15:14:38