MG_256_MONOMER

Name
WID MG_256_MONOMER View in model
 
Genetics
Gene MG_256 View in model
 
Structure
Sequence
1
51
101
151
201
251
MHFNSNFKECFNKIAKKVNSLDSEYYEFSSFIERIRTTFGLLIALTVLSN
LIIISFVLIWFFTDGFGQLRLLFFTLFIPFFISLLVAIFLIFLNNSFRNF
FQINEKNWLFLWTCVFSSLPIFNLWLIVRLNKTIKNFASDYGFKIVNKYN
SLTSGIFVFDFADYVSFEANLTNWKNTNDKNRNFVNFFETISKEKTGVVQ
KPVLNFQRLYVNRLYYQSKLSVGSNQQTPQTAFDNLRNYVENKQRETVRV
KQYILT*
50
100
150
200
250
257
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2164C1437N351O374S3
Molecular weight (pH 7.5; Da) 30436.79 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
42650
Instability index 24.19
Is stable True
Aliphatic index 97.39
GRAVY (25C, pH 7.0) 0.101
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Metadata
Created 2012-10-01 15:07:55
Last updated 2012-10-01 15:14:37