MG_255_MONOMER

Name
WID MG_255_MONOMER View in model
 
Genetics
Gene MG_255 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
MESENQIAILDYIFNQVNQPNQPKIVWFSGEGEDEKINFLIRLNDFFKPK
FVENTNDSSFLLSFRNHVETKNSTPLTQANFANIANKLLAVLFGSLQWKQ
LNKPTGNWFLVILFLALLWLRQCWLKLQLTKISKFVNQKGILSFIKQQWP
ILTTLVTVGTTLGTPVFSLTIAQQDGIKQNAGNDVFIFLIIFSVFSISLG
LVSSLIFLVSSLFSIRQKKTLDALDKVLSKFIDKYFFLDEKEIKKQLKYQ
FKNNGVCFFYGFDFDQAEFLEQSMNLMLLLKQTNCFILVGCKESEMTLIK
NKIEPNINLKQNSFYLDLSNEISQVEQISKFNLLFRQLRLSSELFYLEDF
FDYLTTAKQIVNFLF*
50
100
150
200
250
300
350
366
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H3063C1982N477O539S8
Molecular weight (pH 7.5; Da) 42453.80 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
43930
Instability index 32.23
Is stable True
Aliphatic index 106.50
GRAVY (25C, pH 7.0) 0.0992
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Metadata
Created 2012-10-01 15:07:55
Last updated 2012-10-01 15:14:37