MG_254_MONOMER – DNA ligase, NAD-dependent

Name
WID MG_254_MONOMER View in model
Name DNA ligase, NAD-dependent View in model
Cross references PDB: 2OWO
 
Genetics
Gene MG_254 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
651
VMDVKLKIQQLVNLIKNYDYHYYVLSEPLIDDFEYDMLYKSLQQLEKDHP
DLIQIDSPTQRVGGEAVKGFKKLNHNSPMLSLENAFSTKEIANFIDNINF
QTNSKNEFVVEPKIDGVSISLTYKNGVLVHALTRGDGSVGEDVLNNVKTI
KSIPLTIPFTKTIEIRGEIFVDKKTFLAINNQLEKPFANARNLAAGTIRN
LNSEITAQRKLRALFYYIPNGLEESITTQTMVLEQLKQWKFPVSDTIRVF
QNKFQLINYLEAFDKKREQLTFNLDGLVIKLNSLLFYQQLGATSKSPRWA
IAFKFSPKFVQTKLTAVLITIGRTGRVNYTAKLESVNLDGTKVTAATLHN
FDYIKTKDIRINDTVVIYKAGEIIPKVLKVNLEKRKNDTIIIQEQKYCPS
CNSKLVKIVDEVDQYCTNETCKERNIQLINYFVSKTAMDINGLNINTITK
LYEHNLVRSIVDLYDLKDKKNQVLKLDLKIGDKLFNKLVDNIENSKQKGM
ARLLTGLGIKHVGNVLAKNLANHFKNIKALQHASLENLISLNDVGITVAE
SLYNWFHDPNHLQLIEQLELRQVKTDQLPLKINFETNSIYFQKRFLITGS
FNISRDQIKDLLSAKFDCQFASEVKPTVDFVIAGNKPTLRKINHAKELNI
PIINEAIWT*
50
100
150
200
250
300
350
400
450
500
550
600
650
660
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
DNA footprint Length: 19 (nt), Binding: dsDNA, Region: dsDNA View in model
Empirical formula (pH 7.5) H5484C3415N905O988S11
Molecular weight (pH 7.5; Da) 75380.05 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
53915
Instability index 26.74
Is stable True
Aliphatic index 104.55
GRAVY (25C, pH 7.0) -0.250
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Enzyme View in model
Reaction participant View in model
 
Parameters
Parameters Parameter_0111: ligaseRate = 0.04 1/s View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0333]. Coenzymes Interacts with 1 MG or MN per monomer as prosthetic group [387]. DNA-binding DNA footprint is 19 nt [PUB_0733].
References
  1. Lee JY, Chang C, Song HK, Moon J, Yang JK, Kim HK, Kwon ST, Suh SW. Crystal structure of NAD(+)-dependent DNA ligase: modular architecture and functional implications. EMBO J 19, 1119-29 (2000). WholeCell: PUB_0333, PubMed: 10698952

  2. Shuman S. DNA ligases: progress and prospects. J Biol Chem 284, 17365-9 (2009). WholeCell: PUB_0733, PubMed: 19329793

 
Metadata
Created 2012-10-01 15:07:55
Last updated 2012-10-01 15:14:37