MG_253_MONOMER – cysteinyl-tRNA synthetase

Name
WID MG_253_MONOMER View in model
Name cysteinyl-tRNA synthetase View in model
Cross references PDB: 1U0B
 
Genetics
Gene MG_253 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
MIVDSVSQKPTTLVQKTINIYLCGPTVYNDLHLGNTRPLIVFDVLNRVLK
KAKYTVNFVQNITDIDDKIIKIAQQQEVSESVVTKQQITAYKSLLKKLNI
LPIKHIQITEKIDKIPDYIDQLVNQNHAYVSTQNNVYFAVNSLKQYGYLA
NRMVHLEETDTDKKNKLDFVLWKITTAGIKWNSKWGLGRPGWHVECAFLI
DYCFKNELTIHGGGVDLKFPHHENENALHMALYNQPITKHWMHIGHLMIE
NQKMSKSLQNFLLAVDFLNFHDFRVLRWIFYQKHYLHPIDLNQSLIEKAN
NDIQRIAKTLNVARTWLVYSEQSELISPKQYDPVFSALLDNLNFANAVAA
IWKLIKKINTSIKTKDFSVLREQLSFLEWSIDLLGISFKSIHTKLNVRLI
KEWSILHKQKAMDKADQIRKKLIKKMLL*
50
100
150
200
250
300
350
400
429
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H3627C2288N605O623S11
Molecular weight (pH 7.5; Da) 49930.53 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
77725
Instability index 32.43
Is stable True
Aliphatic index 106.55
GRAVY (25C, pH 7.0) -0.223
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Enzyme cysteinyl-tRNA (MG483) aminoacylation
[c]: ATP + CYSAMP + PPI
View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0356]. Coenzymes Interacts with 1 ZN per monomer as prosthetic group [96].
References
  1. Eriani G, Dirheimer G, Gangloff J. Cysteinyl-tRNA synthetase: determination of the last E. coli aminoacyl-tRNA synthetase primary structure. Nucleic Acids Res 19, 265-9 (1991). WholeCell: PUB_0356, PubMed: 2014166

 
Metadata
Created 2012-10-01 15:07:55
Last updated 2012-10-01 15:14:37