MG_250_MONOMER – DNA primase

Name
WID MG_250_MONOMER View in model
Name DNA primase View in model
Cross references PDB: 3B39
 
Genetics
Gene MG_250 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
MVNKSNSLDELLKQIKITEIIQHYGVKIQTKGNSLLALCPFHDDKNPSMS
ISSSKNIFKCWACNAAGNGIAFIQKHDQLDWKTALKKAIEICGIKLENWN
SNLLTKVDPKQKRYWEINNALITYYQTRLKRETNPNGMNYLVEKRKLNKT
LIEQFQLGLAFHNEDKYLCESMERYPFINPKIKPSELYLFSKTNQQGLGF
FDFNTKKATFQNQIMIPIHDFNGNPVGFSARSVDNINKLKYKNSADHEFF
KKGELLFNFHRLNKNLNQLFIVEGYFDVFTLTNSKFEAVALMGLALNDVQ
IKAIKAHFKELQTLVLALDNDASGQNAVFSLIEKLNNNNFIVEIVQWEHN
YKDWDELYLNKGSEQVILQANKRQNLIEYLVSFFKKQQLDQRVITNKIIA
FLTKNQTILNDHSFLIFLIKNLVKLLEYSDEKTLYETVLKHKEKLVSKFD
NNRFYINTSGHAQPPQELQKTTAALVQTAFEEAVNELWKPEIFAFALIDK
RFLVELKQSHLDEVFKECNFNLFDVELFIEKARIYWSENQTANWVGFESV
LDQNYLLNNKARLLEIKDIFLDELTCYQANDFQNYLKTFQTLLKQQKQRL
KNLKLTL*
50
100
150
200
250
300
350
400
450
500
550
600
608
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
DNA footprint Length: 14 (nt), Binding: ssDNA, Region: xsDNA View in model
Empirical formula (pH 7.5) H5059C3248N846O919S13
Molecular weight (pH 7.5; Da) 71079.68 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
80175
Instability index 29.89
Is stable True
Aliphatic index 94.64
GRAVY (25C, pH 7.0) -0.389
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Enzyme View in model
Complex subunit View in model
 
Parameters
Parameters Parameter_0113: primerLength = 11 nt View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0096]. Coenzymes Interacts with 1 ZN per monomer as prosthetic group [96]. DNA-binding Eukaryotic pol α-primase has 14 nt footprint [PUB_0746].
References
  1. Thompson HC, Sheaff RJ, Kuchta RD. Interactions of calf thymus DNA polymerase alpha with primer/templates. Nucleic Acids Res 23, 4109-15 (1995). WholeCell: PUB_0746, PubMed: 7479073

  2. UniProt Consortium. The Universal Protein Resource (UniProt) 2009. Nucleic Acids Res 37, D169-74 (2009). WholeCell: PUB_0096, PubMed: 18836194, URL: http://www.uniprot.org/uniprot/

 
Metadata
Created 2012-10-01 15:07:54
Last updated 2012-10-01 15:14:37