MG_249_MONOMER – RNA polymerase sigma factor RpoD

Name
WID MG_249_MONOMER View in model
Name RNA polymerase sigma factor RpoD View in model
Cross references PDB: 2P7V
 
Genetics
Gene MG_249 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
MSTDKKTLGEKPNSTKPELSEELIAELKKQRILEKNRPYKKMIYVDNKVQ
RKHRHENIAFLKTLHENKESDVPKKRRGRKPKHAPLKEKNNLKLFDILEG
SLKSHIENDDTNTVINLLTEAWEKKSKKKQKNITLSNKEIISVLAKFELP
EDEIIYVLDELRDKGIQLQHDVEEHIHEFRANQDLSIIDEDIEELTSKNI
SNRDKVDDNVRFFLGSLDFSKMLDFESEQRIAKVLNSTDEESRKYAINQL
VTSNLRLVVSIAKKHLERGLDFNDLIQEGNLGLLKAISKFNWSLGNKFST
YATWWIKQAITRAIADQARTVRIPVHMVETINRLAKAERALYQELGREPT
DEELAEKMGGQAEGFNVKKIAEIKRLSLDPVSLDKTVGHDEESQFGDFVK
DTDAQTPDEFTESRSNSEKIDELLNNNLSEQEELIVRMRIGMPPYNEPKT
LDEVGQKILIPREKIRQIENKAIRKLRHAVRNNPISMSFLRINEKKD*
50
100
150
200
250
300
350
400
450
498
View in model
Is N‑terminal methionine cleaved
No
View in model
DNA footprint Length: 58 (nt), Binding: dsDNA, Region: dsDNA View in model
Empirical formula (pH 7.5) H4138C2542N726O784S8
Molecular weight (pH 7.5; Da) 57670.80 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
32430
Instability index 43.46
Is stable False
Aliphatic index 89.48
GRAVY (25C, pH 7.0) -0.792
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_305_MONOMER View in model
 
Function
Complex subunit DNA-directed RNA polymerase holoenzyme
[c]: MG_249_MONOMER + RNA_POLYMERASERNA_POLYMERASE_HOLOENZYME
View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0355]. Participates in RNA polymerase holoenzyme which has structure β'βα2δσ [PUB_0355]. DNA-binding Sigma factor has 58 nt footprint [PUB_0747].
References
  1. Bordier C, Rossetti GP. Subunit composition of Escherichia coli RNA polymerase during transcription in vitro. Eur J Biochem 65, 147-53 (1976). WholeCell: PUB_0355, PubMed: 776624

  2. Ramesh U, Meares CF. Footprint of the sigma protein. Biochem Biophys Res Commun 160, 121-5 (1989). WholeCell: PUB_0747, PubMed: 2523702

 
Metadata
Created 2012-10-01 15:07:54
Last updated 2012-10-01 15:14:37