MG_247_MONOMER – membrane protein, putative

Name
WID MG_247_MONOMER View in model
Name membrane protein, putative View in model
Cross references PDB: 2NQJ
 
Genetics
Gene MG_247 View in model
 
Structure
Sequence
1
51
101
151
201
MNQASAIAILVIFSLASGYLLGSIIFADIFSKILKKNVREFGSKNPGATN
SMRVFGLKIGFLVAIFDAFKGFFAFLLTWILFRFGLQGYLTEKVYQSTYF
LSYLSCFAATIGHIFPLYFKFKGGKAIATTGGSLLAISLWWFLICLLIWI
MITLITKYVSLASLITFFVLAVIILIPWLDYLYFFNSDPLKSITYQNEWY
IILFFCLWYWPLTVVVFWLHRANIIRILHGKESKITQLN*
50
100
150
200
240
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2025C1345N296O311S6
Molecular weight (pH 7.5; Da) 27509.58 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
67755
Instability index 20.11
Is stable True
Aliphatic index 126.00
GRAVY (25C, pH 7.0) 0.876
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Metadata
Created 2012-10-01 15:07:54
Last updated 2012-10-01 15:14:37