MG_244_MONOMER – 3-5' helicase

Name
WID MG_244_MONOMER View in model
Name 3-5' helicase View in model
 
Genetics
Gene MG_244 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
651
701
MNEQQKQAISCGKGVNVVYSGAGTGKTTIITNRFAYLVNKEKVDPSRILA
ITFTKKAAKEMQFRILKLIDSSLAEKTNIYTFHSFCNKFLIQTLKKRFII
DDDISYFLKEFLADSKLDINLAKQIIDNFKNTFADFEINKLDQDERLISL
CEHSLLNKDEEYSTLKTQLINAFISYEKNKILNNKLDFHDLLIKTCNLLS
NDNDLLNQWSEQFQHILVDEFQDTNQIQYELIKMLVTKNKNLFLVGDNNQ
MIYRWRGAVNGIITALKHDFNVPKSNEFFINQNYRCDQNILAVANQILLK
IMAYEKQVKTEKNLLFSTLNSDKKPVYFQAESVENQANWIFNKIKALNQT
EKINFKDMAILFRKNRDITTMVELIEADGTIPLPKQKSYFNQLVKLQRVL
IAISTRTNLDIKRALQALKIWSNDLKELWKQSDKTNLFDFLKWSELNQKN
HSSKLKATGYFNLLIKLAEDQQINLLFTELFKKLKVDQTIENLLWKKLTE
FQKDKTEFSLSEFITSLALEFDSIIENSSDTINLLTVHAAKGLEFEAVFI
YGMNQGDFPLFLSQNQNDEQHLIDELKLFYVAITRAKRFLFITAVLQINN
NSIKPSSFLNYINKSEYLDIATINYVLEQDDDFFDSTKKTDYTKKLRKES
LDIIVGDLVTSRYFGKGVVVEVRDKEVLVAFKDTRYGMKWILKNHKSLTK
ALY*
50
100
150
200
250
300
350
400
450
500
550
600
650
700
704
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H5897C3731N961O1082S14
Molecular weight (pH 7.5; Da) 81976.21 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
77405
Instability index 23.86
Is stable True
Aliphatic index 99.87
GRAVY (25C, pH 7.0) -0.312
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit 3-5' helicase
[c]: (2) MG_244_MONOMERMG_244_DIMER
View in model
 
Comments
Comments First observed residue by mass-spec 244 [PUB_0280]. Functional Macromolecule Functional as homodimer [PUB_0077].
References
  1. Gupta N, Tanner S, Jaitly N, Adkins JN, Lipton M, Edwards R, Romine M, Osterman A, Bafna V, Smith RD, Pevzner PA. Whole proteome analysis of post-translational modifications: applications of mass-spectrometry for proteogenomic annotation. Genome Res 17, 1362-77 (2007). WholeCell: PUB_0280, PubMed: 17690205

  2. Maluf NK, Fischer CJ, Lohman TM. A Dimer of Escherichia coli UvrD is the active form of the helicase in vitro. J Mol Biol 325, 913-35 (2003). WholeCell: PUB_0077, PubMed: 12527299

 
Metadata
Created 2012-10-01 15:07:54
Last updated 2012-10-01 15:14:37