MG_243_MONOMER – conserved hypothetical protein, authentic frameshift

Name
WID MG_243_MONOMER View in model
Name conserved hypothetical protein, authentic frameshift View in model
 
Genetics
Gene MG_243 View in model
 
Structure
Sequence
1
51
101
151
201
MQIKVINETNKTVQIFQCAKVKHRALAWLCDVFLLAIVLVVIFLITQAFS
DNRFLLFLVLSCSQTILWTVYFIFLPFFWDGKTLFRNLLKIKLFAFDKRF
LRIMIHELFLWILLSVLFLVIASYFFINQNSSEALNFFTNLDKPNAIAIT
IRTITILISFLQLIFIGYFCFSSEKQALQEILSNTFMVQEKHTLKSKPTS
LKTNNQPDPANLPGVIALDEVEKLIN*
50
100
150
200
227
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1946C1247N294O312S7
Molecular weight (pH 7.5; Da) 26272.95 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
26970
Instability index 25.92
Is stable True
Aliphatic index 126.70
GRAVY (25C, pH 7.0) 0.616
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Metadata
Created 2012-10-01 15:07:54
Last updated 2012-10-01 15:14:36