MG_242_MONOMER

Name
WID MG_242_MONOMER View in model
 
Genetics
Gene MG_242 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
MKFNKLNLSHCISFYISEVSEVFFESINQHPSRDFVNNILQKIKTTLSEE
ELEKLNSIEEVTKDEKIVIMLNHVLKKIVSKTGSSKCDLFNVIKQDRFNS
PVYIQSINAFENNLINNEFAERRYDYLIEVNKNSYLKKFVNSIRISFFLD
LRAQILSGSFTLNLVNKSIEKQKKTEIFKDIFVNALVKHFICNQLYPISL
NSFIFDSENPSNKLALKERIKLLKTNWNSLFFDKFYNCLNNKNKQQLQET
SDEMFYAVINTYLIMLISVEELRVYFTSKEPALILKVLDKKNTLREDPDQ
NPETDLYELIQFIEQNYLKKDKKTSWNKKKVQDLEQLLEEINKINLETKN
ESLAYPDEITELEIDNDNFVSTKQVFRNQLELQLLHGIVINPEKYGIGMW
SSYFADWSEYKNLIEQMLNPKSGNDFYQFEKDIDESICQINKKYLTFISS
DSNTFLIVKNDDVKVISNYVWAQLFFETRRWIINDIEFDLYEKGFDKSHF
SRNIALLESLSFSWLDPFYGLTSIKEIMQKIDSKSNLKTSIEEMVNRFKH
EQRINKKDNERVLMIFAYIAAFVVGFINFFSMVFTILTVSDLNAGLTVPN
IIVISIASVLAFILIVIAVLFRFKWKHIKH*
50
100
150
200
250
300
350
400
450
500
550
600
631
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H5293C3403N851O977S15
Molecular weight (pH 7.5; Da) 74239.32 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
77405
Instability index 42.13
Is stable False
Aliphatic index 100.82
GRAVY (25C, pH 7.0) -0.230
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Metadata
Created 2012-10-01 15:07:54
Last updated 2012-10-01 15:14:36