MG_241_MONOMER

Name
WID MG_241_MONOMER View in model
 
Genetics
Gene MG_241 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
MIQKEMEIYNLFTFQIDLDKKLLFEKSNDQKNYSKIRTHYFKHKFKNKSA
VFLNKNLIKNSLNKVLLNFSDFVSGAGIDTVFNQIIDEDPEVLNYLKQVK
KDLSKENNATSQLTFNVTINPKNTLANFFEGFNIYLHFNEENNTVIGSFS
LQWHIKKTDLFSETKNIAINNLIHTFCKNNMHEISFMQIINCFSKTKINK
HGEIVLKSCAFKQKWQNVVAEKYPFSTASKDLEKINDFFDALFVMLLLVC
HLNKNLLWLCEKTDFFEWKPSQKTALFKANDSGAYLARMLLFLNDWYNEN
QAITTADIENVNEVEDIGKLVEKYSTNQPQKLSLNSTVYVLQTKQKQFFL
KNDFFFNNNEAKLFFLITMKPNVFGLDDTAIANNLNLKKISDFFKEIDFN
DEDILNDFKQEQEKLLVRRTFNQLLFMNKNTEILSVVNDKQKSVIHNIVW
TITYSKAIMLKAFDYSKAFEKNRTSDPSLLRSNLTVINRLRYLSEYFQNA
SLKYDLLYTKAKQYMQIDKFINDMIRKVNHEDEIFGKFKERIYLSLGIIS
AVVFGIVEFFNCVWTILTVSQEVVDKSVLDPRNIIFISIGTILVLFLLVT
ILVFMTRRLYLFEINKKHKN*
50
100
150
200
250
300
350
400
450
500
550
600
621
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H5210C3349N845O938S18
Molecular weight (pH 7.5; Da) 72895.26 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
67560
Instability index 29.41
Is stable True
Aliphatic index 96.51
GRAVY (25C, pH 7.0) -0.210
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Metadata
Created 2012-10-01 15:07:54
Last updated 2012-10-01 15:14:36