MG_240_MONOMER – nicotinamide-nucleotide adenylyltransferase/conserved hypothetical protein

Name
WID MG_240_MONOMER View in model
Name nicotinamide-nucleotide adenylyltransferase/conserved hypothetical protein View in model
 
Genetics
Gene MG_240 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
LKQKIIIFGGSFDPIHNAHLYIAKHAIKKIKAQKLFFVPTYNGIFKNNFH
ASNKDRIAMLKLAIKSVNNALVSNFDIKTKNAFSINTVNHFKSCYPTSEI
YFLIGSDKLNELEKWDHIQQLKDLCTFVCYERKPYPFNKKIANQFNVKYL
AKCPLEIASSKLLNQPRKKLIPLAVLNYINTNHLYLIPTLKAMVDDKRFQ
HCLRVGKLAKQLAIANKLDAKRAFVAGAYHDLAKQLPVDQLVNIATSELK
ITNYPSWKVLHSYVGAYILKNWFGVKDKMIINAIKNHTIPPKQVSKLDMI
VYLADKLEPNRKQEQWSGGIEIDQLVKLAKSNLKQAYLITLKYVQNLVKD
*
50
100
150
200
250
300
350
351
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H2979C1857N488O488S9
Molecular weight (pH 7.5; Da) 40237.97 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
46465
Instability index 22.32
Is stable True
Aliphatic index 104.50
GRAVY (25C, pH 7.0) -0.192
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit nicotinamide-nucleotide adenylyltransferase/conserved hypothetical protein
[c]: (6) MG_240_MONOMERMG_240_HEXAMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homohexamer. Coenzymes Monomer interacts with MG with unknown stoichiometry as prosthetic group.
 
Metadata
Created 2012-10-01 15:07:54
Last updated 2012-10-01 15:14:36