MG_239_MONOMER – ATP-dependent protease La

Name
WID MG_239_MONOMER View in model
Name ATP-dependent protease La View in model
Cross references PDB: 2ANE
 
Genetics
Gene MG_239 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
651
701
751
MPVTKKSQILVVRGQVIFPFVPFSLDVGRPRSRKIIKALKTLKTKRLVLV
TQKFTGEQNPEFNDIYHVGTLCEIDEIVDVPGVDSKTVDYRIKGRGLQRV
LIEKFSDADINEVSYQLLNSTVKDEANVDRFLQRIFPEKEEIEQLMEGAE
KFLELENISKTVNVPKGLKQLDIITFKLANLVPNTESIKQAILEENEIAN
RLEKIIQAGIEDLQKIQDYGRSKNKETEFDKLDSKITRKINEQLSRQQRD
FYLREKLRIIREEIGISSKKEDEVASIRKKLDENPYPEAIKKRILSELEH
YENSSSSSQESTLTKTYIDTLLNLPWWQKSKDNSDVKNLIKTLDKNHTGL
DKVKERIVEYLAVQLRTQKNKGPIMCLVGPPGVGKSSLAKSIAEALDKKF
VKISLGGVHDESEIRGHRKTYLGSMPGRILKGMTRAKVINPLFLLDEIDK
MTSSNQGYPSGALLEVLDPELNNKFSDNYVEEDYDLSKVMFIATANYIED
IPEALLDRMEIIELTSYTEQEKIEIAKNHLIKRCLEDADLNSEELKFTDE
AISYIIKFYTREAGVRQLERLIQQVVRKYIVAMQKDGIKQETIDVNAVKK
YLKKEIFDHTMRDEVSLPGIVNGMAYTPTGGDLLPIEVTHVAGKGELILT
GNLKQTMRESANVALGYVKANAERFNINPSLFKKIDINIHVPGGGIPKDG
PSAGAALVTAIISSLTGKKVDPTVAMTGEITLRGKVLVIGGVKEKTISAY
RGGVTTIFMPEKNERYLDEVPKEIVDKLNIIFVKEYSDIYNKLFS*
50
100
150
200
250
300
350
400
450
500
550
600
650
700
750
796
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H6551C4021N1078O1216S17
Molecular weight (pH 7.5; Da) 89997.38 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
48625
Instability index 36.56
Is stable True
Aliphatic index 99.52
GRAVY (25C, pH 7.0) -0.385
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_305_MONOMER, MG_392_393_21MER View in model
 
Function
Complex subunit ATP-dependent protease La
[c]: (6) MG_239_MONOMERMG_239_HEXAMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homohexamer [PUB_0029]. Coenzymes Monomer interacts with MG with unknown stoichiometry as prosthetic group [PUB_0029].
References
  1. Lee I, Suzuki CK. Functional mechanics of the ATP-dependent Lon protease- lessons from endogenous protein and synthetic peptide substrates. Biochim Biophys Acta 1784, 727-35 (2008). WholeCell: PUB_0029, PubMed: 18359303

 
Metadata
Created 2012-10-01 15:07:54
Last updated 2012-10-01 15:14:36