MG_238_MONOMER – trigger factor

Name
WID MG_238_MONOMER View in model
Name trigger factor View in model
Cross references PDB: 1HXV, PDB: 1W2B
 
Genetics
Gene MG_238 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
MKLYKVLNSKTTDKSLCLEVEIDPNYWQATQKKLVGEMAKSIKIKGFRPG
KIPPNLASQSINKAELMQKSAQNVMNSIYESVQQEEIVASNDNVIDDYPT
IDFKTITEQNCVLLFYFDLIPNFQLPDYKKIKDLTPLTKLTEAEFNNEIE
KLAKTKSTMVDVSDKKLANGDIAIIDFTGIVDNKKLASASAQNYELTIGS
NSFIKGFETGLIAMKVNQKKTLALTFPSDYHVKELQSKPVTFEVVLKAIK
KLEFTPMDETNFKSFLPEQFQSFTSLKAFKSYFHKLMENKKQETILQENN
QKIRQFLLTNTKLPFLPEALIKLEANRLLKLQQSQAEQYKIPFEKLLSAS
NITLTELQDRNIKEAKENVTFALVMKKIADIEKIKVDNNKIKAEIENVIA
VEYPFASDEMKKQLFFNMEQQKEFVESIIINRLTTTKIVSYSTH*
50
100
150
200
250
300
350
400
445
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H3703C2306N580O686S13
Molecular weight (pH 7.5; Da) 50945.25 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
23630
Instability index 29.18
Is stable True
Aliphatic index 92.04
GRAVY (25C, pH 7.0) -0.370
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_392_393_21MER View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0006].
References
  1. Keseler IM, Bonavides-Martínez C, Collado-Vides J, Gama-Castro S, Gunsalus RP, Johnson DA, Krummenacker M, Nolan LM, Paley S, Paulsen IT, Peralta-Gil M, Santos-Zavaleta A, Shearer AG, Karp PD. EcoCyc: a comprehensive view of Escherichia coli biology. Nucleic Acids Res 37, D464-70 (2009). WholeCell: PUB_0006, PubMed: 18974181

 
Metadata
Created 2012-10-01 15:07:54
Last updated 2012-10-01 15:14:36