MG_236_MONOMER – ferric uptake repressor

Name
WID MG_236_MONOMER View in model
Name ferric uptake repressor View in model
 
Genetics
Gene MG_236 View in model
 
Structure
Sequence
1
51
101
MLTSYVKVLEQNNLRLTKPRIALLKCLIEHQDWHNLSQIKTHLDLANQPS
TLASIYNNLRILAKLKLINIFVDPERFETYYCLRHAEHNHIYLFDEVKQQ
FFTLPLTDGQIKTLLETQNHTSKVKLNDFYIVARGEINND*
50
100
141
View in model
Is N‑terminal methionine cleaved
No
View in model
DNA footprint Length: 36 (nt), Binding: dsDNA, Region: dsDNA View in model
Empirical formula (pH 7.5) H1182C750N203O212S3
Molecular weight (pH 7.5; Da) 16530.79 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
14690
Instability index 38.06
Is stable True
Aliphatic index 107.87
GRAVY (25C, pH 7.0) -0.319
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Regulation
Regulatory rule stimulus_ironStress View in model
 
Function
Transcriptional regulation View in model
Reaction participant View in model
 
Comments
Comments Consensus sequence GATAATGATAATCATTATC is 19 bp [PUB_0418, PUB_0419, PUB_0438]. Dnase I footprint is 14-28 nt [PUB_0731], 31 nt [PUB_0730, PUB_0732], 36 nt [PUB_0729]; extending to 50-55 at higher fur concentrations [PUB_0729, PUB_0732]. Regulation Activated by iron stress [PUB_0418, PUB_0419, PUB_0438].
References
  1. Althaus EW, Outten CE, Olson KE, Cao H, O'Halloran TV. The ferric uptake regulation (Fur) repressor is a zinc metalloprotein. Biochemistry 38, 6559-69 (1999). WholeCell: PUB_0731, PubMed: 10350474

  2. Baichoo N, Wang T, Ye R, Helmann JD. Global analysis of the Bacillus subtilis Fur regulon and the iron starvation stimulon. Mol Microbiol 45, 1613-29 (2002). WholeCell: PUB_0438, PubMed: 12354229

  3. Güell M, van Noort V, Yus E, Chen WH, Leigh-Bell J, Michalodimitrakis K, Yamada T, Arumugam M, Doerks T, Kühner S, Rode M, Suyama M, Schmidt S, Gavin AC, Bork P, Serrano L. Transcriptome complexity in a genome-reduced bacterium. Science 326, 1268-71 (2009). WholeCell: PUB_0418, PubMed: 19965477

  4. Sierro N, Makita Y, de Hoon M, Nakai K. DBTBS: a database of transcriptional regulation in Bacillus subtilis containing upstream intergenic conservation information. Nucleic Acids Res 36, D93-6 (2008). WholeCell: PUB_0419, PubMed: 17962296, URL: http://dbtbs.hgc.jp/

  5. Tardat B, Touati D. Iron and oxygen regulation of Escherichia coli MnSOD expression: competition between the global regulators Fur and ArcA for binding to DNA. Mol Microbiol 9, 53-63 (1993). WholeCell: PUB_0729, PubMed: 8412671

  6. ... 2 more

  7. de Lorenzo V, Giovannini F, Herrero M, Neilands JB. Metal ion regulation of gene expression. Fur repressor-operator interaction at the promoter region of the aerobactin system of pColV-K30. J Mol Biol 203, 875-84 (1988). WholeCell: PUB_0732, PubMed: 3062182

  8. de Lorenzo V, Wee S, Herrero M, Neilands JB. Operator sequences of the aerobactin operon of plasmid ColV-K30 binding the ferric uptake regulation (fur) repressor. J Bacteriol 169, 2624-30 (1987). WholeCell: PUB_0730, PubMed: 3294800

 
Metadata
Created 2012-10-01 15:07:54
Last updated 2012-10-01 15:14:36