MG_235_MONOMER – apurinic endonuclease

Name
WID	MG_235_MONOMER
Name	apurinic endonuclease
Cross references	PDB: 2NQJ

Genetics
Gene	MG_235

Structure
Sequence	1 51 101 151 201 251 MPKLLGSFISFKAPNYFVQSAQDAIAIDATALMVFLGPPHSAYRVPFNKM QFSLGYELLKTKNINSNGLVVHAPYIINCASKDPLKQQNAISVLTNEIQL CNLAGAHYLVLHPGSAVAQTTNEALDNLVKVLNQVINKTKTTVICLETMA GKGNEIGRDLTELKYVIDRIVDKDRIGVCLDTCHFHDSGIDFSDLTGVFN TITTKLGFEFLKVIHLNESKNNCGSKKDRHANINAGMIGFENLMKFISHP QIKDLPIILETPSTSLNYPTIYREEISQIRSWFKTYQPDAN* 50 100 150 200 250 292
Is N‑terminal methionine cleaved	No
Prosthetic groups	(3) ZN [c]
DNA footprint	Length: 7 (nt), Binding: dsDNA, Region: dsDNA
Empirical formula (pH 7.5)	H₂₃₀₁C₁₄₅₅N₃₈₆O₄₂₆S₁₂
Molecular weight (pH 7.5; Da)	32401.86
Extinction coefficient (260 nm, 25C, pH 7.0)	19660
Instability index	26.51
Is stable	True
Aliphatic index	96.85
GRAVY (25C, pH 7.0)	-0.0849
Half life (OD (600 nm) = 0.3, M9 media, 36C; min)	1200

Synthesis
Localization	c

Function
Enzyme	5'-apurinic/apyrimidinic endonuclease [c]: dRibose5P_dRibose5P + H2O ⇒ (2) DR5P + H 5'-deoxyribophosphodiesterase; exonuclease [c]: dRibose5P_dRibose5P + H2O ⇒ (2) DR5P + H
Reaction participant	DNA bound protein release (apurinic endonuclease releases Spx subfamily protein) MG_127_MONOMER[d] + MG_235_MONOMER[c] ⇒ MG_127_MONOMER[c] + MG_235_MONOMER[d] DNA bound protein release (apurinic endonuclease releases DnaA-ATP) MG_235_MONOMER[c] + MG_469_1MER_ATP[d] ⇒ MG_235_MONOMER[d] + MG_469_1MER_ATP[c] DNA bound protein release (apurinic endonuclease releases DnaA-ATP 4mer) MG_235_MONOMER[c] + MG_469_4MER_ATP[d] ⇒ MG_235_MONOMER[d] + MG_469_4MER_ATP[c] DNA bound protein release (apurinic endonuclease releases DNA gyrase) DNA_GYRASE[d] + MG_235_MONOMER[c] ⇒ DNA_GYRASE[c] + MG_235_MONOMER[d] DNA bound protein release (apurinic endonuclease releases DNA polymerase core, β-clamp, and primase) DNA_POLYMERASE_CORE_BETA_CLAMP_PRIMASE[d] + MG_235_MONOMER[c] ⇒ DNA_POLYMERASE_CORE_BETA_CLAMP_PRIMASE[c] + MG_235_MONOMER[d] ... 30 more DNA bound protein release (apurinic endonuclease releases DnaA-ATP 3mer) MG_235_MONOMER[c] + MG_469_3MER_ATP[d] ⇒ MG_235_MONOMER[d] + MG_469_3MER_ATP[c] DNA bound protein release (apurinic endonuclease releases DnaA 2mer-(1)ATP-(1)ADP) MG_235_MONOMER[c] + MG_469_2MER_1ATP_ADP[d] ⇒ MG_235_MONOMER[d] + MG_469_2MER_1ATP_ADP[c] DNA bound protein release (apurinic endonuclease releases topoisomerase IV) MG_203_204_TETRAMER[d] + MG_235_MONOMER[c] ⇒ MG_203_204_TETRAMER[c] + MG_235_MONOMER[d] DNA bound protein release (apurinic endonuclease releases ferric uptake repressor) MG_235_MONOMER[c] + MG_236_MONOMER[d] ⇒ MG_235_MONOMER[d] + MG_236_MONOMER[c] DNA bound protein release (apurinic endonuclease releases LuxR bacterial regulatory protein, putative) MG_235_MONOMER[c] + MG_428_DIMER[d] ⇒ MG_235_MONOMER[d] + MG_428_DIMER[c] DNA bound protein release (apurinic endonuclease releases replicative DNA helicase) MG_094_HEXAMER[d] + MG_235_MONOMER[c] ⇒ MG_094_HEXAMER[c] + MG_235_MONOMER[d] DNA bound protein release (apurinic endonuclease releases Uncharacterized HTH-type transcriptional regulator) MG_101_MONOMER[d] + MG_235_MONOMER[c] ⇒ MG_101_MONOMER[c] + MG_235_MONOMER[d] DNA bound protein release (apurinic endonuclease releases DnaA-ATP 7mer) MG_235_MONOMER[c] + MG_469_7MER_ATP[d] ⇒ MG_235_MONOMER[d] + MG_469_7MER_ATP[c] DNA bound protein release (apurinic endonuclease releases DnaA-ATP 2mer) MG_235_MONOMER[c] + MG_469_2MER_ATP[d] ⇒ MG_235_MONOMER[d] + MG_469_2MER_ATP[c] DNA bound protein release (apurinic endonuclease releases DNA polymerase (2) core, β-clamp, γ-complex, and primase) DNA_POLYMERASE_2CORE_BETA_CLAMP_GAMMA_COMPLEX_PRIMASE[d] + MG_235_MONOMER[c] ⇒ DNA_POLYMERASE_2CORE_BETA_CLAMP_GAMMA_COMPLEX_PRIMASE[c] + MG_235_MONOMER[d] DNA bound protein release (apurinic endonuclease releases DnaA-ADP) MG_235_MONOMER[c] + MG_469_1MER_ADP[d] ⇒ MG_235_MONOMER[d] + MG_469_1MER_ADP[c] DNA bound protein release (apurinic endonuclease releases DNA-directed RNA polymerase) MG_235_MONOMER[c] + RNA_POLYMERASE[d] ⇒ MG_235_MONOMER[d] + RNA_POLYMERASE[c] DNA bound protein release (apurinic endonuclease releases DNA polymerase III, beta clamp) MG_001_DIMER[d] + MG_235_MONOMER[c] ⇒ MG_001_DIMER[c] + MG_235_MONOMER[d] DNA bound protein release (apurinic endonuclease releases adenine-specific DNA modification methylase) MG_184_DIMER[d] + MG_235_MONOMER[c] ⇒ MG_184_DIMER[c] + MG_235_MONOMER[d] DNA bound protein release (apurinic endonuclease releases single-strand binding protein family, octamer) MG_091_OCTAMER[d] + MG_235_MONOMER[c] ⇒ MG_091_OCTAMER[c] + MG_235_MONOMER[d] DNA bound protein release (apurinic endonuclease releases DNA-directed RNA polymerase holoenzyme) MG_235_MONOMER[c] + RNA_POLYMERASE_HOLOENZYME[d] ⇒ MG_235_MONOMER[d] + RNA_POLYMERASE_HOLOENZYME[c] DNA bound protein release (apurinic endonuclease releases DnaA 3mer-(2)ATP-(1)ADP) MG_235_MONOMER[c] + MG_469_3MER_2ATP_ADP[d] ⇒ MG_235_MONOMER[d] + MG_469_3MER_2ATP_ADP[c] DNA bound protein release (apurinic endonuclease releases DNA ligase, NAD-dependent) MG_235_MONOMER[c] + MG_254_MONOMER[d] ⇒ MG_235_MONOMER[d] + MG_254_MONOMER[c] DNA bound protein release (apurinic endonuclease releases DnaA-ATP 5mer) MG_235_MONOMER[c] + MG_469_5MER_ATP[d] ⇒ MG_235_MONOMER[d] + MG_469_5MER_ATP[c] DNA bound protein release (apurinic endonuclease releases DnaA 6mer-(5)ATP-(1)ADP) MG_235_MONOMER[c] + MG_469_6MER_5ATP_ADP[d] ⇒ MG_235_MONOMER[d] + MG_469_6MER_5ATP_ADP[c] DNA bound protein release (apurinic endonuclease releases DnaA 7mer-(6)ATP-(1)ADP) MG_235_MONOMER[c] + MG_469_7MER_6ATP_ADP[d] ⇒ MG_235_MONOMER[d] + MG_469_7MER_6ATP_ADP[c] DNA bound protein release (apurinic endonuclease releases type I restriction modification DNA specificity domain protein) MG_235_MONOMER[c] + MG_438_MONOMER[d] ⇒ MG_235_MONOMER[d] + MG_438_MONOMER[c] DNA bound protein release (apurinic endonuclease releases DNA topoisomerase I) MG_122_MONOMER[d] + MG_235_MONOMER[c] ⇒ MG_122_MONOMER[c] + MG_235_MONOMER[d] DNA bound protein release (apurinic endonuclease releases heat-inducible transcription repressor HrcA, putative) MG_205_DIMER[d] + MG_235_MONOMER[c] ⇒ MG_205_DIMER[c] + MG_235_MONOMER[d] DNA bound protein release (apurinic endonuclease releases DnaA 4mer-(3)ATP-(1)ADP) MG_235_MONOMER[c] + MG_469_4MER_3ATP_ADP[d] ⇒ MG_235_MONOMER[d] + MG_469_4MER_3ATP_ADP[c] DNA bound protein release (apurinic endonuclease releases Chromosome Segregation Protein SMC with SCP Proteins-ADP) MG_213_214_298_6MER_ADP[d] + MG_235_MONOMER[c] ⇒ MG_213_214_298_6MER_ADP[c] + MG_235_MONOMER[d] DNA bound protein release (apurinic endonuclease releases DnaA-ATP 6mer) MG_235_MONOMER[c] + MG_469_6MER_ATP[d] ⇒ MG_235_MONOMER[d] + MG_469_6MER_ATP[c] DNA bound protein release (apurinic endonuclease releases putative DNA integrity scanning protein) MG_105_OCTAMER[d] + MG_235_MONOMER[c] ⇒ MG_105_OCTAMER[c] + MG_235_MONOMER[d] DNA bound protein release (apurinic endonuclease releases DNA polymerase core, β-clamp, and γ-complex) DNA_POLYMERASE_CORE_BETA_CLAMP_GAMMA_COMPLEX[d] + MG_235_MONOMER[c] ⇒ DNA_POLYMERASE_CORE_BETA_CLAMP_GAMMA_COMPLEX[c] + MG_235_MONOMER[d] DNA bound protein release (apurinic endonuclease releases DnaA 5mer-(4)ATP-(1)ADP) MG_235_MONOMER[c] + MG_469_5MER_4ATP_ADP[d] ⇒ MG_235_MONOMER[d] + MG_469_5MER_4ATP_ADP[c]

Comments
Comments	Functional Macromolecule Functional as monomer [PUB_0076]. Coenzymes Interacts with 3 ZN per monomer as prosthetic group [96]. DNA-binding Ape1 footprint is 7 nt [PUB_0718].
References	Ishchenko AA, Sanz G, Privezentzev CV, Maksimenko AV, Saparbaev M. Characterisation of new substrate specificities of Escherichia coli and Saccharomyces cerevisiae AP endonucleases. Nucleic Acids Res 31, 6344-53 (2003). WholeCell: PUB_0076, PubMed: 14576322 Nguyen LH, Barsky D, Erzberger JP, Wilson DM 3rd. Mapping the protein-DNA interface and the metal-binding site of the major human apurinic/apyrimidinic endonuclease. J Mol Biol 298, 447-59 (2000). WholeCell: PUB_0718, PubMed: 10772862

Metadata
Created	2012-10-01 15:07:54
Last updated	2012-10-01 15:14:36


WholeCellKB Google