MG_235_MONOMER – apurinic endonuclease

Name
WID MG_235_MONOMER View in model
Name apurinic endonuclease View in model
Cross references PDB: 2NQJ
 
Genetics
Gene MG_235 View in model
 
Structure
Sequence
1
51
101
151
201
251
MPKLLGSFISFKAPNYFVQSAQDAIAIDATALMVFLGPPHSAYRVPFNKM
QFSLGYELLKTKNINSNGLVVHAPYIINCASKDPLKQQNAISVLTNEIQL
CNLAGAHYLVLHPGSAVAQTTNEALDNLVKVLNQVINKTKTTVICLETMA
GKGNEIGRDLTELKYVIDRIVDKDRIGVCLDTCHFHDSGIDFSDLTGVFN
TITTKLGFEFLKVIHLNESKNNCGSKKDRHANINAGMIGFENLMKFISHP
QIKDLPIILETPSTSLNYPTIYREEISQIRSWFKTYQPDAN*
50
100
150
200
250
292
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
DNA footprint Length: 7 (nt), Binding: dsDNA, Region: dsDNA View in model
Empirical formula (pH 7.5) H2301C1455N386O426S12
Molecular weight (pH 7.5; Da) 32401.86 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
19660
Instability index 26.51
Is stable True
Aliphatic index 96.85
GRAVY (25C, pH 7.0) -0.0849
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Enzyme View in model
Reaction participant View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0076]. Coenzymes Interacts with 3 ZN per monomer as prosthetic group [96]. DNA-binding Ape1 footprint is 7 nt [PUB_0718].
References
  1. Ishchenko AA, Sanz G, Privezentzev CV, Maksimenko AV, Saparbaev M. Characterisation of new substrate specificities of Escherichia coli and Saccharomyces cerevisiae AP endonucleases. Nucleic Acids Res 31, 6344-53 (2003). WholeCell: PUB_0076, PubMed: 14576322

  2. Nguyen LH, Barsky D, Erzberger JP, Wilson DM 3rd. Mapping the protein-DNA interface and the metal-binding site of the major human apurinic/apyrimidinic endonuclease. J Mol Biol 298, 447-59 (2000). WholeCell: PUB_0718, PubMed: 10772862

 
Metadata
Created 2012-10-01 15:07:54
Last updated 2012-10-01 15:14:36