MG_233_MONOMER

Name
WID MG_233_MONOMER View in model
 
Genetics
Gene MG_233 View in model
 
Structure
Sequence
1
51
MIKINISQNFLVAKGHALFAEKGKDIVCAAISGIIFGGVAWFEPDKIEFT
ENKLVPSIALKLIDPTPNVAVAFSVITVQLKAIANSYPNHIVINEESYE*
50
100
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H783C500N121O140S2
Molecular weight (pH 7.5; Da) 10793.39 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
8605
Instability index 27.74
Is stable True
Aliphatic index 115.10
GRAVY (25C, pH 7.0) 0.401
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Metadata
Created 2012-10-01 15:07:54
Last updated 2012-10-01 15:14:36