MG_231_MONOMER – ribonucleoside-diphosphate reductase, alpha chain

Name
WID MG_231_MONOMER View in model
Name ribonucleoside-diphosphate reductase, alpha chain View in model
 
Genetics
Gene MG_231 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
651
701
MTSKEKIPTFNTEEDVESYISFNAQAKIYDDFAIDLQAVESYIQEHVKPK
TKVFHSTKERLDFLIKNDYYDEKIINMYSFEQFEEITHKAYSYRFRYANF
MGAFKFYNAYALKTFDGKYYLENYEDRVVMNVLMLANGNFNKALKLLKQI
ILNRFQPATPTFLNAGRKKRGEFVSCYLLRIEDNMESIGRAITTTLQLSK
RDGGVALLLSNLREAGAPIKKIENQSSGIIPIMKLLEDSFSYSNQLGQRQ
GAGAVYLHCHHPDVMQFLDTKRENADEKIRIKSLSLGLVIPDITFQLAKN
NEMMALFSPYDIYQEYGKALSDISVTEMYYELLENQRIKKTFISARKFFQ
TIAELHFESGYPYILFDDTVNRRNAHKNRIVMSNLCSEIVQPSLPSEFYS
DLTFKKVGSDISCNLGSLNIARAMESGSELAELIQLAIESLDLVSRISSL
ETAPSIKKGNSENHALGLGAMNLHGFLATNAIYYDSKEAVDFTNIFFYTV
AYHAFSASNKLALELGKFKDFENTKFADGSYFDKYTKVASDFWTCKTEKV
QALFDKYQVKIPTQENWKQLVASIQKDGLANSHLMAIAPTGSISYLSSCT
PSLQPVVSPVEVRKEGKLGRIYVPAYKLDNDNYQYFKDGAYELGFEPIIN
IVAAAQQHVDQAISLTLFMTDKATTRDLNKAYIYAFKKGCSSIYYVRVRQ
DVLKDSEDHTIKIKDCEVCSI*
50
100
150
200
250
300
350
400
450
500
550
600
650
700
722
View in model
Is N‑terminal methionine cleaved
No
View in model
Disulfide_bonds MG_229_231_TETRAMER_ox: 176-413 View in model
Empirical formula (pH 7.5) H5756C3716N957O1101S25
Molecular weight (pH 7.5; Da) 82254.61 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
74705
Instability index 34.31
Is stable True
Aliphatic index 86.09
GRAVY (25C, pH 7.0) -0.284
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit ribonucleoside-diphosphate reductase
[c]: (2) MG_229_MONOMER + (2) MG_231_MONOMERMG_229_231_TETRAMER
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see MG_229_231_TETRAMER).
 
Metadata
Created 2012-10-01 15:07:54
Last updated 2012-10-01 15:14:36