MG_230_MONOMER – ribonucleotide reductase stimulatory protein

Name
WID MG_230_MONOMER View in model
Name ribonucleotide reductase stimulatory protein View in model
 
Genetics
Gene MG_230 View in model
 
Structure
Sequence
1
51
101
151
MHKDIKLVKETEIRKPIGSPFIVYFSSISNNTHRFIEKLGFQHKRIPVDI
TQSITVSNEYVLICPTYSGGGNQVEGAVPKQVIQFLNNKHNRELCRGVIA
SGNTNFGDTFCLAGTVISKKLNVPLLYQFELLGTKNDVEQTQKIIANFFQ
NSN*
50
100
150
154
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1228C774N211O225S4
Molecular weight (pH 7.5; Da) 17217.52 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
6335
Instability index 29.49
Is stable True
Aliphatic index 91.04
GRAVY (25C, pH 7.0) -0.224
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Enzyme ribonucleoside-diphosphate reductase maintenance
[c]: (2) FMNH2 + (2) MG_124_MONOMER + MG_229_231_TETRAMER_ox ⇒ (2) FMN + (2) H2O + (2) MG_124_MONOMER_ox + MG_229_231_TETRAMER
View in model
 
Comments
Comments Coenzymes Monomer interacts with FMN with unknown stoichiometry as coenzyme [160].
 
Metadata
Created 2012-10-01 15:07:54
Last updated 2012-10-01 15:14:36