MG_228_MONOMER – dihydrofolate reductase

Name
WID MG_228_MONOMER View in model
Name dihydrofolate reductase View in model
Cross references PDB: 1DDS, PDB: 7DFR
 
Genetics
Gene MG_228 View in model
 
Structure
Sequence
1
51
101
151
MLIAIWAMTQEGLIGNNNTLPWMIKQELAHFKKTTLFQALLMGRKTYESL
PKVFEKRTIFLLSKDQNYRFEEKGSEVKVINDFWPLIKSYQANKEKDLFI
CGGKSVYEQTINECDQLIVSIIKKKYKGDQFLKVDLSKFVLNEVVEFEEF
NVNYYRKKQQ*
50
100
150
161
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1367C873N218O242S6
Molecular weight (pH 7.5; Da) 18980.85 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
27180
Instability index 20.59
Is stable True
Aliphatic index 88.94
GRAVY (25C, pH 7.0) -0.396
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit dihydrofolate reductase
[c]: (4) MG_228_MONOMERMG_228_TETRAMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homotetramer.
 
Metadata
Created 2012-10-01 15:07:53
Last updated 2012-10-01 15:14:35