MG_227_MONOMER – thymidylate synthase

Name
WID MG_227_MONOMER View in model
Name thymidylate synthase View in model
Cross references PDB: 2KCE, PDB: 3TMS
 
Genetics
Gene MG_227 View in model
 
Structure
Sequence
1
51
101
151
201
251
MKQYLDLASYVLANGKKRKNRTDTDTLSVFGYQMKFDLTNSFPLLTTKKV
NWKAIVHELLWFIKGDTNIKYLVDNGVNIWNEWPYENFKKSPSFQNETLQ
EFILKVKTDNEFAKQFADLGPVYGKQWRNFNGVDQLKKVIQEIKENPNSR
RLIVSSWNPSELEKMALAPCHSLFQFYVEEDKLSLQLYQRSGDIFLGVPF
NIASYALLVYLVAHETKLKPGYFIHTLGDAHIYENHIEQIKLQLTRTTLD
PPQVVLKSDKSIFAYSFDDIELVGYNYHPFIYGRVAV*
50
100
150
200
250
288
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H2360C1550N390O431S4
Molecular weight (pH 7.5; Da) 33481.84 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
56965
Instability index 35.16
Is stable True
Aliphatic index 91.01
GRAVY (25C, pH 7.0) -0.335
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit thymidylate synthase
[c]: (2) MG_227_MONOMERMG_227_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer. Coenzymes Monomer interacts with MG with unknown stoichiometry as prosthetic group.
 
Metadata
Created 2012-10-01 15:07:53
Last updated 2012-10-01 15:14:35