MG_225_MONOMER – amino acid-polyamine-organocation (APC) permease

Name
WID MG_225_MONOMER View in model
Name amino acid-polyamine-organocation (APC) permease View in model
 
Genetics
Gene MG_225 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
MGQINRKFSEKQFLLFVVNYIAGFGFIATAISLFRLGPFSWLIFLLVSLV
SLIVTLSFARLSSIDSQNYGGPYLWAKKAVDKEKIAGRMFSFFTGWNNFI
IGPLSAATAPLFILNSFSGIDGIRGNLVNTWILIAIGFSFYVLLAFISTK
GTSLNKKLIALFASVKWIVILSALIVAIYVIARDGNGYSQNNNLESGFFG
RREISFAQIATVFITFFYSYAGVEDISVMTPDVKTNNFRKILIVSFIAVF
LFYFIGIIILNGLQNIAQRGGEANSIGNVADIFKKAAGLGTLIFYGVGAL
FNNVSTRLSTIIANSRKILPLAYDNYLPSFFYKQNKKGEFQNAIWFTFGT
TLIAMTLLVFIPLVASNFDFDNATEYAASVGSAATLLQYIFVFFIIFKFI
YKKEPLYQKKWVKTTEELLFCLGTIVIVLMLLVYLFPVIDGFSKWETKHT
LTIVLYGVLSLIGLVLFLLQEYKHKNKQNANKQTTQTTV*
50
100
150
200
250
300
350
400
450
490
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H4014C2607N612O667S6
Molecular weight (pH 7.5; Da) 54793.70 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
73925
Instability index 25.48
Is stable True
Aliphatic index 116.22
GRAVY (25C, pH 7.0) 0.596
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Function
Complex subunit amino acid transporter
[m]: (2) MG_225_MONOMERMG_225_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer [PUB_0246].
References
  1. Casagrande F, Ratera M, Schenk AD, Chami M, Valencia E, Lopez JM, Torrents D, Engel A, Palacin M, Fotiadis D. Projection structure of a member of the amino acid/polyamine/organocation transporter superfamily. J Biol Chem 283, 33240-8 (2008). WholeCell: PUB_0246, PubMed: 18819925

 
Metadata
Created 2012-10-01 15:07:53
Last updated 2012-10-01 15:14:35