MG_224_MONOMER – cell division protein FtsZ

Name
WID MG_224_MONOMER View in model
Name cell division protein FtsZ View in model
Cross references PDB: 1F47
 
Genetics
Gene MG_224 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
MDENETQFNKLNQVKNKLKIGVFGIGGAGNNIVDASLYHYPNLASENIHF
YAINSDLQHLAFKTNVKNKLLIQDHTNKGFGAGGDPAKGASLAISFQEQF
NTLTDGYDFCILVAGFGKGTGTGATPVFSKILKTKKILNVAIVTYPSLNE
GLTVRNKATKGLEILNKATDSYMLFCNEKCTNGIYQLANTEIVSAIKNLI
ELITIPLQQNIDFEDVRAFFQTKKTNQDQQLFTVTHPFSFSFDSKDSIEQ
FAKQFKNFEKVSYFDHSIVGAKKVLLKANINQKIVKLNFKQIQDIIWTKI
DNYQLEIRLGVDFVTTIPNIQIFILSEHKNPVSLPIDNKSTENNQNKLKL
LDELKELGMKYVKHQNQIY*
50
100
150
200
250
300
350
370
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2976C1889N492O553S6
Molecular weight (pH 7.5; Da) 41619.08 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
22265
Instability index 30.64
Is stable True
Aliphatic index 93.81
GRAVY (25C, pH 7.0) -0.272
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_305_MONOMER View in model
 
Function
Reaction participant FtsZ activation
[c]: GTP + MG_224_MONOMERMG_224_MONOMER_GTP
View in model
Complex subunit View in model
 
Parameters
Parameters Parameter_0084: activationFwd = 1.1 1/s View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0096]. Polymerizes to form septal ring [PUB_0096].
References
  1. UniProt Consortium. The Universal Protein Resource (UniProt) 2009. Nucleic Acids Res 37, D169-74 (2009). WholeCell: PUB_0096, PubMed: 18836194, URL: http://www.uniprot.org/uniprot/

 
Metadata
Created 2012-10-01 15:07:53
Last updated 2012-10-01 15:14:35