MG_222_MONOMER – S-adenosyl-methyltransferase MraW

Name
WID MG_222_MONOMER View in model
Name S-adenosyl-methyltransferase MraW View in model
 
Genetics
Gene MG_222 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
MLNNQQIHQSVLINEVIHNLNINPCGNYLDLTAGFAGHSQKILEKLTTGT
LTINDVDKESINFCQKLFFKNNNVVIIHDNFANFPVHLKQLSITKFDGIL
MDLGVSSHQLNQPNRGFSFKNDGPIDMRMDQSNQKNTALTVLKNLTEQKL
SLILKKYGDIKHPKPIAIGLKKAVQTEKNLTTTQLAKVVKECATGFEKYQ
SRNYLAKVFQAIRIYLNDEITNLKTALTFIPNLLKNNSRFLVIVFHSIEE
KIVRNFIAKLTSFIQPEALPIKLTPAYQLITKKPILPSQKELELNPRSRS
AKLFVIQKN*
50
100
150
200
250
300
310
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2588C1591N430O449S7
Molecular weight (pH 7.5; Da) 35148.54 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
9315
Instability index 27.39
Is stable True
Aliphatic index 104.10
GRAVY (25C, pH 7.0) -0.225
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Comments
Comments Coenzymes Monomer interacts with AMET with unknown stoichiometry as coenzyme.
 
Metadata
Created 2012-10-01 15:07:53
Last updated 2012-10-01 15:14:35