MG_221_MONOMER – mraZ protein

Name
WID MG_221_MONOMER View in model
Name mraZ protein View in model
 
Genetics
Gene MG_221 View in model
 
Structure
Sequence
1
51
101
MLLGTFNLTLDNKNRISLPAKLRSFFDSSIVINRGFENCLEIRKPADFES
YFQTFNNFPNTQKDTRTLKRLIFANANLVELDSANRILIPNNLISDAKLD
KEIVLIGQFDHLEVWDKVQYEQYLASSESLETVAERMKDAK*
50
100
142
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1152C732N196O220S3
Molecular weight (pH 7.5; Da) 16314.31 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
10095
Instability index 30.04
Is stable True
Aliphatic index 95.49
GRAVY (25C, pH 7.0) -0.334
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit mraZ protein
[c]: (8) MG_221_MONOMERMG_221_OCTAMER
View in model
 
Comments
Comments Functional Macromolecule Functional as octamer [PUB_0096].
References
  1. UniProt Consortium. The Universal Protein Resource (UniProt) 2009. Nucleic Acids Res 37, D169-74 (2009). WholeCell: PUB_0096, PubMed: 18836194, URL: http://www.uniprot.org/uniprot/

 
Metadata
Created 2012-10-01 15:07:53
Last updated 2012-10-01 15:14:35