MG_220_MONOMER

Name
WID MG_220_MONOMER View in model
 
Genetics
Gene MG_220 View in model
 
Structure
Sequence
1
51
MYKLEKAQAKQVVGGLSFWTFSAGLIMIVNALTGVAHAVNDIFQSTTANA
NGSDDDNENKNNSYRSKSNYFNTARFKLGLTPGSSSYSFPVFS*
50
94
View in model
Is N‑terminal methionine cleaved
No
View in model
Sequence sequence Type: secretory, Location: N, Length: 37 (nt) View in model
Empirical formula (pH 7.5) H685C451N121O141S2
Molecular weight (pH 7.5; Da) 10122.09 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
11460
Instability index 23.79
Is stable True
Aliphatic index 65.43
GRAVY (25C, pH 7.0) -0.286
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization e View in model
 
Metadata
Created 2012-10-01 15:07:53
Last updated 2012-10-01 15:14:35