MG_217_MONOMER – P65 adhesin

Name
WID MG_217_MONOMER View in model
Name P65 adhesin View in model
 
Genetics
Gene MG_217 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
MEKNRSAFQQNQQASNQPFNQDQNQYYQDPNQQQFNQSGFDPNQQQFNQP
GFDPNQQYYQDPNQQQFNQAGFDQNQQYYQDPNQQQFNQPGFDPNQQYYQ
DPNQQQFNQAGFDQNQYYQDPNQQQFNQSGFDQNQYYQDPNQQQFNQPSF
DLNNQQFNQPGFNQSPAFEITPQEQKAEQEMFGEEPPQVVREIHELPFEK
IRSFLQSDFDSYNFRLNSLKSKLDNALYSLDKTIQNTNENTANLEAIRHN
LEQKIQNQSKQLRTNFDTQKLDDKINELEIRMQKLTRNFESLSELSKHNS
YPNYYEKLLPNGGDSMTNVFEKALMMNLLRTTLPPQPQVQYYPQPYPYIR
PYYDEPIYAGFRRRGYRDDFYE*
50
100
150
200
250
300
350
373
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2856C1970N552O637S6
Molecular weight (pH 7.5; Da) 44655.35 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
38740
Instability index 52.93
Is stable False
Aliphatic index 39.52
GRAVY (25C, pH 7.0) -1.47
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization tc View in model
 
Comments
Comments Burgos et al suggest that MG_217 modules terminal organelle curvature to enable M. genitalium to move in specific directions [PUB_0806]. MG_217 knocks are still able to glide, but move in erratic or wide circular paths [PUB_0806]. Stable modifications Phosphorylation observed by mass-spec [PUB_0094].
References
  1. Burgos R, Pich OQ, Querol E, Piñol J. Deletion of the Mycoplasma genitalium MG_217 gene modifies cell gliding behaviour by altering terminal organelle curvature. Mol Microbiol 69, 1029-40 (2008). WholeCell: PUB_0806, PubMed: 18573175

  2. Su HC, Hutchison CA 3rd, Giddings MC. Mapping phosphoproteins in Mycoplasma genitalium and Mycoplasma pneumoniae. BMC Microbiol 7, 63 (2007). WholeCell: PUB_0094, PubMed: 17605819

 
Metadata
Created 2012-10-01 15:07:53
Last updated 2012-10-01 15:14:35