MG_216_MONOMER – pyruvate kinase

Name
WID MG_216_MONOMER View in model
Name pyruvate kinase View in model
Cross references PDB: 1PKY
 
Genetics
Gene MG_216 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
MIDHLKRTKIIATCGPALTKSLVSLKMLDDNEYAAIKKVAYANIEAIIKS
GVSVIRLNFSHGTHEEQQVRIKIVRDVAKAMNIPVSIMLDTNGPEIRIVE
TKKEGLKITKDSEVIINTMSKMIASDNQFAVSDASGKYNMVNDVNIGQKI
LVDDGKLTLVVTRVDKQHNQVICVAKNDHTVFTKKRLNLPNAQYSIPFLS
EKDLKDIDFGLSQGIDYIAASFVNTVADIKQLRDYLKLKNASGVKIIAKI
ESNHALNNIDKIIKASDGIMVARGDLGLEIPYYQVPYWQRYMIKACRFFN
KRSITATQMLDSLEKNIQPTRAEVTDVYFAVDRGNDATMLSGETASGLYP
LNAVAVMQKIDKQSETFFDYQYNVNYYLKNSTANKSRFWHNVVLPLTKKT
VPKRKLVNSAFKYDFIVYPTNNINRIYALSNARLAAAVIILTNNKRVYTG
HGVDYGIFCYLIDKNPNQLTKAELIELAWKAINHYQAYGDLEKLKQCLAV
YNETIINL*
50
100
150
200
250
300
350
400
450
500
509
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H4147C2575N693O750S17
Molecular weight (pH 7.5; Da) 57358.61 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
54375
Instability index 29.20
Is stable True
Aliphatic index 100.77
GRAVY (25C, pH 7.0) -0.179
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_305_MONOMER View in model
 
Function
Complex subunit pyruvate kinase
[c]: (4) MG_216_MONOMERMG_216_TETRAMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homotetramer. Coenzymes Interacts with 3 MG per monomer as prosthetic group [96,387].
 
Metadata
Created 2012-10-01 15:07:53
Last updated 2012-10-01 15:14:34