MG_215_MONOMER – 6-phosphofructokinase

Name
WID MG_215_MONOMER View in model
Name 6-phosphofructokinase View in model
Cross references PDB: 2PFK
 
Genetics
Gene MG_215 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
MDKIAILTSGGDASGMNATIAYLTKYAIAKQLEVFYVKNGYYGLYHNHFI
TSKELDLTDFFFMGGTVIGSSRFKQFQDPSLRKQAVLNLKKRGINNLVVI
GGDGSYMGAKALSELGLNCFCLPGTIDNDVNSSEFTIGFWTALEAIRVNV
EAIYHTTKSHNRLAIIEVMGRDCSDLTIFGGLATNASFVVTSKNSLDLNG
FEKAVRKVLQFQNYCVVLVSENIYGKNGLPSLEMVKEHFENNAIKCNLVS
LGHTQRGFSPNSIELFQISLMAKHTIDLVVNNANSQVIGMKNNQAVNYDF
NTAFNLPKADRTKLLNQVNTAII*
50
100
150
200
250
300
324
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H2513C1595N428O472S13
Molecular weight (pH 7.5; Da) 35653.35 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
22515
Instability index 24.99
Is stable True
Aliphatic index 94.78
GRAVY (25C, pH 7.0) -0.00679
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit 6-phosphofructokinase
[c]: (4) MG_215_MONOMERMG_215_TETRAMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homotetramer. Coenzymes Monomer interacts with MG with unknown stoichiometry as prosthetic group.
 
Metadata
Created 2012-10-01 15:07:53
Last updated 2012-10-01 15:14:34