MG_214_MONOMER – segregation and condensation protein B

Name
WID MG_214_MONOMER View in model
Name segregation and condensation protein B View in model
 
Genetics
Gene MG_214 View in model
 
Structure
Sequence
1
51
101
151
201
MKTTINIATPTLKKPSKEANLVASIYGLLFVCGAKGITLRELIRIFKKAG
IEKVKLALLALERKLADDEQSGVELKKFGNSFSLVTKPIIKDYLHLLLAH
KVKNPLNSKAMEVLAIIAYNQPCTRPRINEIRGVDSFQIVDDLIAKELIV
ELGRTDKPGRPFIYEVSAKFYDLFGIDSLDQLPKIEHFDLDKFKQGSFFD
SNRYGDE*
50
100
150
200
208
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1723C1068N276O300S4
Molecular weight (pH 7.5; Da) 23357.97 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
9190
Instability index 20.34
Is stable True
Aliphatic index 106.44
GRAVY (25C, pH 7.0) -0.111
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit chromosome segregation protein SMC
[c]: (2) MG_213_MONOMER + (2) MG_214_MONOMER + (2) MG_298_MONOMERMG_213_214_298_6MER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer [PUB_0096, PUB_0337].
References
  1. Mascarenhas J, Volkov AV, Rinn C, Schiener J, Guckenberger R, Graumann PL. Dynamic assembly, localization and proteolysis of the Bacillus subtilis SMC complex. BMC Cell Biol 6, 28 (2005). WholeCell: PUB_0337, PubMed: 15987505

  2. UniProt Consortium. The Universal Protein Resource (UniProt) 2009. Nucleic Acids Res 37, D169-74 (2009). WholeCell: PUB_0096, PubMed: 18836194, URL: http://www.uniprot.org/uniprot/

 
Metadata
Created 2012-10-01 15:07:53
Last updated 2012-10-01 15:14:34