MG_213_MONOMER – segregation and condensation protein A

Name
WID MG_213_MONOMER View in model
Name segregation and condensation protein A View in model
 
Genetics
Gene MG_213 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
MISLIFDKSNSFNPQLCVELLNHFKVVMLTKTIVVDYPSFQAWKAQLKPF
KLAVFSDNLQTELTPNSKLTVFNNYQQLLVDNNDLIIFATPTLVQLFDNE
IDQLIVINPTSKSKDQFNCNWNDFVLIKQTNFKNHQVGYFDKKSSYEPPF
TVVTDHFFGNLTDLFSLLVDKKVSVNDVDIGLISLQYLNIIANYTNKKAI
EKITDYLVITSKILAKKADNLLNDHQEESVLEYDLATNNFRDKMIANLVE
HKRYCDSLGEFEKLRVNRLAYFSKANEMEQFIKTANDQLVTVEDQLPNYI
SVLKLFHAMNKLLEMRLSSLLTNKNITIKELSVEQVQKELVLAIKQFNYQ
TVSLKRVLLKLNHPISLMYFVTAFVALLVLLNNQVIGLEQKDYHSELYIF
LLDENQLKTFQESPDEMVKRIQAQQQQNELIIAKNKQLRAIKNKQKRADY
LKKKYGENYLDKTNLKDENNN*
50
100
150
200
250
300
350
400
450
472
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H3945C2492N640O726S11
Molecular weight (pH 7.5; Da) 54839.40 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
38195
Instability index 23.42
Is stable True
Aliphatic index 104.45
GRAVY (25C, pH 7.0) -0.272
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit chromosome segregation protein SMC
[c]: (2) MG_213_MONOMER + (2) MG_214_MONOMER + (2) MG_298_MONOMERMG_213_214_298_6MER
View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0337].
References
  1. Mascarenhas J, Volkov AV, Rinn C, Schiener J, Guckenberger R, Graumann PL. Dynamic assembly, localization and proteolysis of the Bacillus subtilis SMC complex. BMC Cell Biol 6, 28 (2005). WholeCell: PUB_0337, PubMed: 15987505

 
Metadata
Created 2012-10-01 15:07:53
Last updated 2012-10-01 15:14:34