MG_212_MONOMER – 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative

Name
WID MG_212_MONOMER View in model
Name 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative View in model
 
Genetics
Gene MG_212 View in model
 
Structure
Sequence
1
51
101
151
201
251
MDKLFKTSFRFIIRFLQILSLPVVFPYFLLSFLACLITSKNYESLPYNYP
PEIRFKKVYRLVSMWLYIKGIKVVTVNDKIIPKKPVLVVANHKSNLDPLV
LIKAFGRLKNSPPLTFVAKIELKDTVLFKLMKLIDCVFIDRKNIRQIANA
LETQQQLIRQGTAIAVFAEGTRILSNDIGEFKPGALKVAYNAFVPILPVS
IVGSLGKMESNKRLKEHGVKKSSNYEVKVIFNKLINPISFNQIDSNNLAN
NIRSIISDAYTSEKPSND*
50
100
150
200
250
269
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2288C1412N361O374S6
Molecular weight (pH 7.5; Da) 30497.77 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
19160
Instability index 29.17
Is stable True
Aliphatic index 113.01
GRAVY (25C, pH 7.0) 0.0955
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Function
Enzyme View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0352]. May form dimers [PUB_0352].
References
  1. Wilkison WO, Bell RM. sn-Glycerol-3-phosphate acyltransferase from Escherichia coli. Biochim Biophys Acta 1348, 3-9 (1997). WholeCell: PUB_0352, PubMed: 9370310

 
Metadata
Created 2012-10-01 15:07:53
Last updated 2012-10-01 15:14:34