MG_211_MONOMER

Name
WID MG_211_MONOMER View in model
 
Genetics
Gene MG_211 View in model
 
Structure
Sequence
1
51
101
MDNKNPQKLITSELLANHRFNFAKDDKGGYDANEVDAFLDQLTKTLIHYE
EMKNNEQELKNAYDKLFSDRDQILSRCAKLEADLNTFYENGYANKVLINR
VQELEDKLEKLPDRYTEKLERIEKLLKKVIKHWTDGEDISNFEDEFF*
50
100
148
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1198C777N207O246S3
Molecular weight (pH 7.5; Da) 17471.21 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
14565
Instability index 25.25
Is stable True
Aliphatic index 79.12
GRAVY (25C, pH 7.0) -0.939
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Metadata
Created 2012-10-01 15:07:53
Last updated 2012-10-01 15:14:34