MG_210_MONOMER – prolipoprotein signal peptidase, signal peptidase II

Name
WID MG_210_MONOMER View in model
Name prolipoprotein signal peptidase, signal peptidase II View in model
 
Genetics
Gene MG_210 View in model
 
Structure
Sequence
1
51
101
151
MKLRKTKFFSQLKHQVLTANQKPFLFYKLTMIGFVGFIILLQVFILRNAL
NGEMDNTMVANSGFINIYVIRNKGVGFSLLQNQTGLVYFLQGLLSVIALV
FLVFMVKYSYIFWITTLAFGSLGNFFDRLTSANDSVLDYFIFQNGSSVFN
FADCCITFGFIGLFFCFLIQMFKEFKHSKNQ*
50
100
150
182
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1498C990N232O245S9
Molecular weight (pH 7.5; Da) 20858.42 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
14815
Instability index 18.44
Is stable True
Aliphatic index 103.85
GRAVY (25C, pH 7.0) 0.600
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Parameters
Parameters Parameter_0105: lipoproteinSignalPeptidaseSpecificRate = 11 1/s View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0007].
References
  1. Dev IK, Ray PH. Signal peptidases and signal peptide hydrolases. J Bioenerg Biomembr 22, 271-90 (1990). WholeCell: PUB_0007, PubMed: 2202720

 
Metadata
Created 2012-10-01 15:07:53
Last updated 2012-10-01 15:14:34