MG_208_MONOMER – glycoprotease

Name
WID MG_208_MONOMER View in model
Name glycoprotease View in model
 
Genetics
Gene MG_208 View in model
 
Structure
Sequence
1
51
101
151
MFFLSKYKLFLDCAYKTLNIIILEMKTNAVVDELSIGVEQNLTELAVYYL
ETMLTKNKLKKSSIKQFYVTIGPGSFTGQRIATIIAKSWCLLYPSCELYA
LNSLRFQIPYEHGISKISCGNDQNYCGLYSQTTSEIKLISKADFVKLCKA
NNELPMYENFENIESYSKLLLSNIDHFERIEDPLTLQPIYLKDPVN*
50
100
150
197
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1608C1029N247O299S10
Molecular weight (pH 7.5; Da) 22543.84 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
25620
Instability index 35.62
Is stable True
Aliphatic index 101.47
GRAVY (25C, pH 7.0) -0.0538
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit glycoprotease family protein
[c]: (2) MG_208_MONOMERMG_208_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer [PUB_0006, PUB_0427]. S. typhimurium YeaZ forms dimer [PUB_0427].
References
  1. Keseler IM, Bonavides-Martínez C, Collado-Vides J, Gama-Castro S, Gunsalus RP, Johnson DA, Krummenacker M, Nolan LM, Paley S, Paulsen IT, Peralta-Gil M, Santos-Zavaleta A, Shearer AG, Karp PD. EcoCyc: a comprehensive view of Escherichia coli biology. Nucleic Acids Res 37, D464-70 (2009). WholeCell: PUB_0006, PubMed: 18974181

  2. Nichols CE, Johnson C, Lockyer M, Charles IG, Lamb HK, Hawkins AR, Stammers DK. Structural characterization of Salmonella typhimurium YeaZ, an M22 O-sialoglycoprotein endopeptidase homolog. Proteins 64, 111-23 (2006). WholeCell: PUB_0427, PubMed: 16617437

 
Metadata
Created 2012-10-01 15:07:52
Last updated 2012-10-01 15:14:34