MG_207_MONOMER – Ser/Thr protein phosphatase 2A

Name
WID MG_207_MONOMER View in model
Name Ser/Thr protein phosphatase 2A View in model
 
Genetics
Gene MG_207 View in model
 
Structure
Sequence
1
51
101
151
LQNKLIKVLVIADTHGQNQRWIELKNYHNPDVIIHAGDHMTTKQFMDQNA
TFWVAGNNDSIGNEIEIFQLGQINFVLMHGHQAPRDNLKKWYQLLVLKAQ
QYPCDVLIFGHSHIEYTNKINMIQLINPGSLQLPRNQTNTPSYCTFIVNK
DELTDLTIHYYQASKVS*
50
100
150
168
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1341C871N238O250S6
Molecular weight (pH 7.5; Da) 19338.75 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
27180
Instability index 41.20
Is stable False
Aliphatic index 93.99
GRAVY (25C, pH 7.0) -0.373
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0331].
References
  1. Strack S, Ruediger R, Walter G, Dagda RK, Barwacz CA, Cribbs JT. Protein phosphatase 2A holoenzyme assembly: identification of contacts between B-family regulatory and scaffolding A subunits. J Biol Chem 277, 20750-5 (2002). WholeCell: PUB_0331, PubMed: 11929880

 
Metadata
Created 2012-10-01 15:07:52
Last updated 2012-10-01 15:14:34