MG_206_MONOMER – excinuclease ABC, C subunit

Name
WID MG_206_MONOMER View in model
Name excinuclease ABC, C subunit View in model
Cross references PDB: 1KFT
 
Genetics
Gene MG_206 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
LTTNLKQKLKTAPKKPGCYLWKDSNGKVLYVGKASNIFNRVHQYFQKNNP
YKTQLLSSQISDVDFFILKDENDALNLEAKLINQYQPRFNLVLKQNNGYL
YFYITKAKKPTLELARKYQIKTTKCFGPFASSKFKLREIHDLLLKLFPLR
KCAPHQKNHPCFYFQMGLCMGQCMQTDTKEKYQQVISNIEQFFNDPSVVI
NYLKAAEKKASDNQEFEKAQQFLTLQKAVLELTKTHHTTIIKQKSSHDFI
GYVFQNNVLAITIFCYEKGELTDKEQAVFTLEQTDIVEVESAIITFIYHH
YKTTPLPSKITVSLDETNLKLISDSLKIGVFKPKNGNEKLILQTVIDNAK
HALATKWLKFTSNYDKTQLHKDLAQLLNTDYIHSLEIIDVSFYDQNHVVG
CMLRFEDGKKIKHLSRRYNINSLKKGDTNHIALLVYRRILSAMQTKANLP
FSDLLIIDGGKAQIKSVKQVFSLFSNVKPPIIIGLVKNKNHQTDHIMLSD
FQVKKIAINSPLFHYLATIQTEVDGFAKRSAFNKLSNHQLQNPLLQIPGV
GKITAQILFDNFQTLNNIKLASVNELSQFIKKPLAQKIKTYFAKQTD*
50
100
150
200
250
300
350
400
450
500
550
598
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H4991C3136N824O877S14
Molecular weight (pH 7.5; Da) 68717.89 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
46270
Instability index 29.00
Is stable True
Aliphatic index 94.41
GRAVY (25C, pH 7.0) -0.333
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit DNA incision complex
[c]: MG_073_MONOMER + MG_206_MONOMER + (2) MG_421_MONOMERMG_073_206_421_TETRAMER
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see MG_073_206_421_TRIMER).
 
Metadata
Created 2012-10-01 15:07:52
Last updated 2012-10-01 15:14:34