MG_205_MONOMER – heat-inducible transcription repressor HrcA, putative

Name
WID MG_205_MONOMER View in model
Name heat-inducible transcription repressor HrcA, putative View in model
 
Genetics
Gene MG_205 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
MKNLTPRQAQILKAIINEYIAYAIPVGSKLLTKKYFKNLSGGTLRNEMAA
LEKKGFLKKNHISSGRVPSQIGYQYYVKVLNVSNTTNDLKTRLRSVILQQ
HKTIDEVIELGVKFINEIINLPVVLTNFSSDEVLKKIDLIILDKSFALFL
LVSASGKVFKKTISYANQRQFEDIVICVRIFNDRIIDTRFSEINNQLEVL
KEIIRTKVHEYQYVIDEILFKLFDLDQIEANKKIYGIQYLAKQPEFANQE
KLTKILNLLEDTSVWQQMAFINQTNQKTNIVFGDQLGFKEISVASTLINT
TSEAKHQLAIVGPTRMDYQKIKALLTTLKEEIEKYDKKIHNQT*
50
100
150
200
250
300
344
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2918C1799N469O516S5
Molecular weight (pH 7.5; Da) 39533.46 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
24995
Instability index 28.64
Is stable True
Aliphatic index 109.65
GRAVY (25C, pH 7.0) -0.188
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit heat-inducible transcription repressor HrcA, putative
[c]: (2) MG_205_MONOMERMG_205_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer [PUB_0206].
References
  1. Kwon HY, Kim EH, Tran TD, Pyo SN, Rhee DK. Reduction-sensitive and cysteine residue-mediated Streptococcus pneumoniae HrcA oligomerization in vitro. Mol Cells 27, 149-57 (2009). WholeCell: PUB_0206, PubMed: 19277496

 
Metadata
Created 2012-10-01 15:07:52
Last updated 2012-10-01 15:14:34