MG_203_MONOMER – DNA topoisomerase IV, B subunit

Name
WID MG_203_MONOMER View in model
Name DNA topoisomerase IV, B subunit View in model
Cross references PDB: 1S16
 
Genetics
Gene MG_203 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
MKSNYSATNIKILKGLDAVKKRPGMYIGSTDSKGLHHMLWEILANSVDEV
LAGYATNITVTLDLNNTITVSDDGRGIPYEIHQDSNISTIDTVFTFLHAG
GKFDDQSYKLAGGLHGVGASVVNALSDHLEVTVKRNGQIYQSVYQAGGKI
IQKAKKIGDTTSHGTTVSFHADPKVFKKAQFDSNIIKSRLKELSFLFAKL
KLTFTDQKTNKTTVFFSTSGLVQFLDEINNTVETLGQKTLIKGEKDGIEV
EVVFQFNQSDQETILSFANSIKTFEGGSHENGFCLAISDVINSYCRKYNL
LKEKDKNFQLSEIRQGLNAIIKVNLPEKNIAFEGQTKSKLFSKEVKNVVY
ELVQQHYFQFLERNNNDAKLIIDKLLNARKIKEQIKQQRELKKSLSSPQK
EKILFGKLAPCQTKKTSEKELFIVEGDSAGGTAKMGRDRIFQAILPLRGK
VLNVEKINNKKEAITNEEILTLIFCIGTGILTNFNIKDLKYGKIIIMTDA
DNDGAHIQILLLTFFYRYMQPLIELGHVYLALPPLYKLETKDRKTVKYLW
SDLELESVKLKLNNFTLQRYKGLGEMNADQLWDTTMNPTTRKLVQVKLDD
LINAEKQINIFMGEKSDLRKHWIEANINFSVEN*
50
100
150
200
250
300
350
400
450
500
550
600
634
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H5167C3222N857O954S13
Molecular weight (pH 7.5; Da) 71590.31 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
49320
Instability index 26.89
Is stable True
Aliphatic index 95.33
GRAVY (25C, pH 7.0) -0.330
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit topoisomerase IV
[c]: (2) MG_203_MONOMER + (2) MG_204_MONOMERMG_203_204_TETRAMER
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see MG_203_204_TETRAMER) [PUB_0006].
References
  1. Keseler IM, Bonavides-Martínez C, Collado-Vides J, Gama-Castro S, Gunsalus RP, Johnson DA, Krummenacker M, Nolan LM, Paley S, Paulsen IT, Peralta-Gil M, Santos-Zavaleta A, Shearer AG, Karp PD. EcoCyc: a comprehensive view of Escherichia coli biology. Nucleic Acids Res 37, D464-70 (2009). WholeCell: PUB_0006, PubMed: 18974181

 
Metadata
Created 2012-10-01 15:07:52
Last updated 2012-10-01 15:14:33