MG_202_MONOMER

Name
WID MG_202_MONOMER View in model
 
Genetics
Gene MG_202 View in model
 
Structure
Sequence
1
51
101
MSEQKRRTIQIAISEDHYEELQKALELLKGTQLPFSTTVEQFVELILSNY
VATSNKISSLAKSGFDVASLQQELEKIGNLSGVDDNLKGFLSELLKTSRN
GFSNPNKDGKKNDDDNNSSSKS*
50
100
123
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H945C587N162O201S1
Molecular weight (pH 7.5; Da) 13519.78 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
2980
Instability index 50.17
Is stable False
Aliphatic index 82.44
GRAVY (25C, pH 7.0) -0.671
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Metadata
Created 2012-10-01 15:07:52
Last updated 2012-10-01 15:14:33