MG_201_MONOMER – co-chaperone GrpE

Name
WID MG_201_MONOMER View in model
Name co-chaperone GrpE View in model
 
Genetics
Gene MG_201 View in model
 
Structure
Sequence
1
51
101
151
201
MCEKSQTIKELLNAIRTLVVKNNKAKVSMIEKELLAFVSELDKKFKQQLN
NFNELQQKIPLLQKANEEFALKFERMQREAQNQIQAKLDELNLKNKKELE
QAKKYAIAKTLDQPLNIIDQFEIALSYAQKDPQVKNYTTGFTMVLDAFSR
WLEANGVTKIKIEPGMEFDEKIMSALELVDSNLAKNKVVRVSKSGYKLYD
KVIRFASVFVSKGNKKS*
50
100
150
200
218
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1843C1124N299O329S7
Molecular weight (pH 7.5; Da) 25033.85 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
13075
Instability index 31.91
Is stable True
Aliphatic index 92.61
GRAVY (25C, pH 7.0) -0.481
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_305_MONOMER, MG_392_393_21MER View in model
 
Function
Complex subunit co-chaperone GrpE
[c]: (2) MG_201_MONOMERMG_201_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer [PUB_0096].
References
  1. UniProt Consortium. The Universal Protein Resource (UniProt) 2009. Nucleic Acids Res 37, D169-74 (2009). WholeCell: PUB_0096, PubMed: 18836194, URL: http://www.uniprot.org/uniprot/

 
Metadata
Created 2012-10-01 15:07:52
Last updated 2012-10-01 15:14:33