MG_199_MONOMER – ribonuclease HIII, putative, frameshift

Name
WID MG_199_MONOMER View in model
Name ribonuclease HIII, putative, frameshift View in model
 
Genetics
Gene MG_199 View in model
 
Structure
Sequence
1
51
101
151
201
LQHYKPADFYLIGSDESGKGDSFGGICVSAVLIEKKQLINLENLQVTDSK
KLSDHTVKLLAKSIQTTVMDHHTITLDPKQYNDLTKSLKNTNLLLTNLHC
QLYQKLLEKNQLLRQTVTISIDQFANQELFVNYLNKLTNFTDKTVLLPDQ
FLINGETKSLVIAAASILARDSFINQLQLLNQKVNYDLPKGSSHGIEQAL
LFLNQQRGFSQIEQFKQVAKLNFKNVTKFLQQLVY*
50
100
150
200
236
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H1941C1208N319O357S3
Molecular weight (pH 7.5; Da) 26741.38 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
10680
Instability index 24.80
Is stable True
Aliphatic index 107.80
GRAVY (25C, pH 7.0) -0.227
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Comments
Comments Coenzymes Interacts with 1 MG per monomer as prosthetic group [387].
 
Metadata
Created 2012-10-01 15:07:52
Last updated 2012-10-01 15:14:33